DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and CG14305

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster


Alignment Length:269 Identity:98/269 - (36%)
Similarity:167/269 - (62%) Gaps:8/269 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LEEHGIILGKVIGTGNYAKV-KIGFSEEYGKRV--AVKIISKVKAPSEYTQKFLPREIEAVKGLH 132
            |.:.|..:|..||.|:||.| ..|:::::|..|  |.|||.|.|||:::..||.|||:|.:..:.
  Fly    23 LAQRGYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTKID 87

  Fly   133 HENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVH 197
            |.|:|..:..::...::::.|:.||||.||.:::....:||.||:..|.|:..|::|:|:..:.|
  Fly    88 HSNIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAH 152

  Fly   198 RDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDI 262
            ||:||||:||.:..|:||.||||||. .|..:.:.:.|:|:|||.|||:||::.|..|||.::|.
  Fly   153 RDLKCENILLSKRLNIKLADFGFARY-CRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLADA 216

  Fly   263 WACGVVCYAMVFGRLPYDGSNVHILLK-RINQSLVFPK--SPSASSECKHMIMHILAP-VKIRYN 323
            |:.||:.:.|:..::|:|.||:..||: :.|:...|.:  ..:.|::.|..:..:|.| ...|:|
  Fly   217 WSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVSVLLEPEAHARWN 281

  Fly   324 IPQVKEDPW 332
            :.::....|
  Fly   282 LREILNCAW 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 97/265 (37%)
S_TKc 78..332 CDD:214567 95/260 (37%)
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 97/265 (37%)
S_TKc 28..287 CDD:214567 95/259 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3315
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29081
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 1 1.000 - - FOG0007569
OrthoInspector 1 1.000 - - mtm4795
orthoMCL 1 0.900 - - OOG6_103794
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X507
109.910

Return to query results.
Submit another query.