DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Nuak1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001369005.1 Gene:Nuak1 / 41256 FlyBaseID:FBgn0262617 Length:2803 Species:Drosophila melanogaster


Alignment Length:295 Identity:109/295 - (36%)
Similarity:168/295 - (56%) Gaps:24/295 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PSGVVPVKADD------------KSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAV 104
            |||:...:.|:            .:..:|.:.:...||  |.:|.|.|.||::|.::|.|:.||:
  Fly    36 PSGIPQDQIDNIMSGIANTGNVKMNNHRKKLRQRFDII--KKLGQGTYGKVQLGINKETGQEVAI 98

  Fly   105 KIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERK 169
            |.|.|.|..:|.....:.||::.:..:||.|:|..|:..|...::.|:|:.|..|.|.||:.|||
  Fly    99 KTIKKCKIEAEADLVRIRREVQIMSSVHHPNIIHIYEVFENREKMVLVMEFAAGGELYDYLSERK 163

  Fly   170 FLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVIL 234
            .|.|.::|.:|:|:.:||.|.|...:.|||:|.||:||||..|.|:.|||.    :...|:|.:|
  Fly   164 VLTEEEARRIFRQVATAVYYCHKHKICHRDLKLENILLDEKGNAKIADFGL----SNVFDDQRLL 224

  Fly   235 SKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVF-P 298
            . |||||..||||||::|..|.....|.|:.||:.|.:|:|.:|:||||...|:|:|:|...: |
  Fly   225 G-TFCGSPLYASPEIVEGTPYQGPEVDCWSLGVLLYTLVYGSMPFDGSNFKRLVKQISQGDYYEP 288

  Fly   299 KSPS-ASSECKHMIMHILAPVKIRYNIPQVKEDPW 332
            :.|| ||:..:.|:  .:.|.| |.:|.|:....|
  Fly   289 RKPSRASTLIRDML--TVCPRK-RASIEQICSHWW 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 104/260 (40%)
S_TKc 78..332 CDD:214567 101/255 (40%)
Nuak1NP_001369005.1 STKc_NUAK 68..321 CDD:270975 104/263 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.