DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and sff

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster


Alignment Length:257 Identity:87/257 - (33%)
Similarity:144/257 - (56%) Gaps:10/257 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQS 142
            |.|.:|.|....||:|.....||:||:|||::.|.......| :.|||..:|.:.|.:::.....
  Fly    20 LEKTLGKGQTGLVKLGVHCVIGKKVAIKIINREKLSESVLMK-VEREIAIMKLIDHPHVLGLSDV 83

  Fly   143 IETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLL 207
            .|....:|||::....|.|.||:.::..|...::|..|:|::||:::.||..:.|||:|.|||||
  Fly    84 YENKKYLYLILEHVSGGELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLL 148

  Fly   208 DENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAM 272
            ||..|:|:.|||.|......|     :.:|.|||..||.||:::|..||...:|:|:|||:.||:
  Fly   149 DEKNNIKIADFGMASLQPAGS-----MLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILYAL 208

  Fly   273 VFGRLPYDGSNVHILLKRINQSLVFPKSPSASSECKHMIMHILA--PVKIRYNIPQVKEDPW 332
            :.|.||:|..|:..||:::.:. ||........:|:.::..::.  |.: |..:.::...||
  Fly   209 LVGALPFDDDNLRQLLEKVKRG-VFHIPHFVPPDCQSLLRGMIEVNPDR-RLTLAEINRHPW 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 87/257 (34%)
S_TKc 78..332 CDD:214567 85/255 (33%)
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 87/257 (34%)
S_TKc 18..269 CDD:214567 87/257 (34%)
UBA_BRSK 298..350 CDD:270525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461624
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.