DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Gm5157

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_011249060.1 Gene:Gm5157 / 381937 MGIID:3648211 Length:301 Species:Mus musculus


Alignment Length:256 Identity:85/256 - (33%)
Similarity:121/256 - (47%) Gaps:44/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 IGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIETS 146
            :|.|.::.||..|.......|||||:...|   |||.. :.||...:|.|.|.|:|..:..::..
Mouse    33 LGEGKFSVVKRAFHVPTSTSVAVKILQNTK---EYTSP-ICREARIMKSLSHPNIIKLFHVVQRR 93

  Fly   147 HRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENW 211
            ...||:|:.|..|.|.|.:.:...|:|.::|.||.|:|.||:|.|...:||||||..|:|:|...
Mouse    94 ETTYLVMEYASEGELQDRIIKVGSLEESKTRRLFAQIVHAVQYCHDHHIVHRDIKASNILIDCRG 158

  Fly   212 NLKLIDFGFARKDTRTSDNQVILSKT---FCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMV 273
            |.||.|||.|.        :||..:.   |||:..|.:||:|:...|:....|||:.||:.:.||
Mouse   159 NAKLCDFGLAA--------EVIPGQKLAGFCGTLPYCAPELLQAEKYEGPPVDIWSLGVLLFLMV 215

  Fly   274 FGRLPYDGS-------------------------NVHILLKRINQSLVFPKSPSASSECKH 309
            .|.||:.|.                         ||.|.|..||.|    :.|:.....:|
Mouse   216 SGNLPFQGKSFVDLKQEIISANFSIPSHVPIDIFNVIIELLMINPS----RRPTIHQIMRH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 85/256 (33%)
S_TKc 78..332 CDD:214567 85/256 (33%)
Gm5157XP_011249060.1 STKc_AMPK-like 26..273 CDD:270905 85/256 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.