DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and 4921509C19Rik

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_941057.1 Gene:4921509C19Rik / 381393 MGIID:2685851 Length:640 Species:Mus musculus


Alignment Length:273 Identity:92/273 - (33%)
Similarity:145/273 - (53%) Gaps:27/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHEN 135
            |.||..|| ..:|.|.:.:||:........:||:||:.|.:..|     .:..|||.:|.|.|.:
Mouse    20 LTEHYEIL-TTLGQGTFGEVKLASHLVTQTKVAIKILPKSRKNS-----LVQPEIEIMKSLDHPH 78

  Fly   136 LITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDI 200
            :|.....|:|:..::::::.|..|.|:..:.|..:|.|.:...||||||.|::|.|.||:||||:
Mouse    79 IIKLLHIIDTTRNIFIVLEHAVGGELMSRIEEFGYLAEVECHRLFKQLVYALQYCHEKGIVHRDL 143

  Fly   201 KCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSK---TFCGSYAYASPEILKGVAYDPFMSDI 262
            |.||:|||...|:||.|||...|        :|:.:   ||||:..|.:||:.:...||...:|:
Mouse   144 KPENILLDHRGNVKLTDFGLGTK--------IIMGQKLVTFCGTLPYCAPELFEDRGYDGRATDV 200

  Fly   263 WACGVVCYAMVFGRLPYDGSNVHILLKRINQSLV---FPKSPSASSECKHMIMHILA--PVKIRY 322
            |:.|||.|.|..|.||::|.:    .:.|.|.::   :|:|.|.|.|...:|..:|.  |.: |.
Mouse   201 WSLGVVLYFMATGCLPFNGYS----YEAIKQKIIAGKYPRSFSLSPELWEVIAKLLTVNPGE-RP 260

  Fly   323 NIPQVKEDPWYSP 335
            .:..:....|..|
Mouse   261 TVHDIARFKWLKP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 87/265 (33%)
S_TKc 78..332 CDD:214567 86/261 (33%)
4921509C19RikNP_941057.1 STKc_AMPK-like 23..270 CDD:270905 88/265 (33%)
UBA_MARK_Par1 290..328 CDD:270522
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 464..509
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..576
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 617..640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.