DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Gm14147

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001365536.1 Gene:Gm14147 / 381390 MGIID:3651555 Length:640 Species:Mus musculus


Alignment Length:277 Identity:91/277 - (32%)
Similarity:145/277 - (52%) Gaps:27/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 QKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGL 131
            ::..|.||..|| ..:|.|.:..||:........:||:||:     |.......:..|||.:|.|
Mouse    16 EEAALTEHYEIL-TTLGQGTFGDVKLANHLVTQTKVAIKIL-----PQNRKNPLVQPEIEIMKSL 74

  Fly   132 HHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVV 196
            .|.::|.....|:|:..::::::.|..|.|::.:.|..:|.|.:...||||||.|::|.|.||:|
Mouse    75 DHPHIIKLLHIIDTTRNIFIVLEHAVGGELMNRIEEFGYLAEVECHRLFKQLVYALQYCHEKGIV 139

  Fly   197 HRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSK---TFCGSYAYASPEILKGVAYDPF 258
            |||:|.||:|||...|:||.|||...|        :|:.:   ||||:..|.:||:.:...||..
Mouse   140 HRDLKPENILLDHRGNVKLTDFGLGTK--------IIMGQKLVTFCGTLPYCAPELFEDRGYDGR 196

  Fly   259 MSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLV---FPKSPSASSECKHMIMHILA--PV 318
            .:|:|:.|||.|.|..|.||::|.:    .:.|.|.::   :|:|.|.|.|...:|..:|.  |.
Mouse   197 ATDVWSLGVVLYFMATGCLPFNGYS----YEAIKQKIIAGKYPRSFSLSPELWEVIAKLLTVNPG 257

  Fly   319 KIRYNIPQVKEDPWYSP 335
            : |..:..:....|..|
Mouse   258 E-RPTVHDIARFKWLKP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 86/265 (32%)
S_TKc 78..332 CDD:214567 85/261 (33%)
Gm14147NP_001365536.1 STKc_AMPK-like 23..270 CDD:270905 87/265 (33%)
UBA_MARK_Par1 290..328 CDD:270522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.