DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Sik3

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001188969.1 Gene:Sik3 / 37152 FlyBaseID:FBgn0262103 Length:1471 Species:Drosophila melanogaster


Alignment Length:298 Identity:115/298 - (38%)
Similarity:162/298 - (54%) Gaps:21/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PQPKPPAPSGVVPVKADDKSKPQKTILEEHGII-LGKVIGTGNYAKVKIGFSEEYGKRVAVKIIS 108
            |...||..|.....|....||.....|...|.. |.|.||.||:|.||:..:.....:||:|||.
  Fly     9 PAAAPPTSSTPQNYKVPSTSKISVDKLLRVGYYELEKTIGKGNFAVVKLATNIVTKTKVAIKIID 73

  Fly   109 KVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDE 173
            |.....||..|.. |||..:|.|.|.::...|:.:|:...:||:.:.|.||.:.|::.....:.|
  Fly    74 KTCLNEEYLNKTF-REIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKE 137

  Fly   174 PQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFAR--KDTRTSDNQVILSK 236
            |::..:|.||||||.|.|.:||||||:|.||:|||::.|:||.||||:.  ::..|       .|
  Fly   138 PEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMNIKLADFGFSNHYEEGAT-------LK 195

  Fly   237 TFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKSP 301
            |:|||..||:||:.:|:.||...||||:.|||.||:|.|.||:||..:..|..|:    |..|..
  Fly   196 TWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRV----VLGKFR 256

  Fly   302 ---SASSECKHMI--MHILAPVKIRYNIPQVKEDPWYS 334
               ..|.||:.:|  |.::.|.: ||.|.|:.:..|.|
  Fly   257 IPFFMSQECEQLIRNMLVVEPDR-RYTIKQIIKHRWLS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 105/265 (40%)
S_TKc 78..332 CDD:214567 104/260 (40%)
Sik3NP_001188969.1 PKc_like 40..292 CDD:304357 104/264 (39%)
S_TKc 41..292 CDD:214567 104/263 (40%)
UBA_SIK 335..380 CDD:270523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.