DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and CG4629

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster


Alignment Length:277 Identity:90/277 - (32%)
Similarity:143/277 - (51%) Gaps:10/277 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RPPQPKPPAPSGVVPVKADDKSKPQKTILEEHGI--ILGKVIGTGNYAKVKIGFSEEYGKRVAVK 105
            :||.|.||.......::.|.:...:.||....|:  ..|. ||.||::|||:...:....:||:|
  Fly    32 QPPPPTPPYQRLTKALQCDPRCGHEVTIGRRIGLYRFCGD-IGRGNFSKVKLAVHQLTRDKVAIK 95

  Fly   106 IISKVKAPSE-YTQKFLPREIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERK 169
            ::...:|..: ...:.|..||..::.:||.|::..::.:||..||||:.:....|.|.:::.:..
  Fly    96 VVDLDRAGLDAKALRMLSSEIATLECVHHPNILRLFEVVETLGRVYLVTEWIRGGELYNHITQGG 160

  Fly   170 FLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVIL 234
            .|.|..:..|.|||:.||:::||.|.||||||.||:||.....|||.||||:.:....::.::  
  Fly   161 PLREIHAAPLLKQLLLAVKHMHSLGYVHRDIKAENVLLLSEDRLKLADFGFSTQLINGANQKL-- 223

  Fly   235 SKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRI-NQSLVFP 298
             .|||||..||:||:.....|.....|:||.|::.|.||.|.:|:....:..|...| ....:.|
  Fly   224 -DTFCGSPPYAAPELFSDDHYIGAPVDVWALGILLYFMVVGNMPFRAPTIPGLKAAILKGDYLLP 287

  Fly   299 KSPSASSECKHMIMHIL 315
              ...|..|..:|..||
  Fly   288 --GQLSLPCIRLIQRIL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 82/245 (33%)
S_TKc 78..332 CDD:214567 81/240 (34%)
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 82/246 (33%)
S_TKc 66..321 CDD:214567 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.