DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Sik2

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_569972.1 Gene:Sik2 / 31170 FlyBaseID:FBgn0025625 Length:1398 Species:Drosophila melanogaster


Alignment Length:297 Identity:113/297 - (38%)
Similarity:161/297 - (54%) Gaps:18/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PQPKPPAPS-GVVPVKADDKSK---PQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVK 105
            |.|.|.:.: |...:...|..|   |.:....:    :.:.||.||:|.||:.........||:|
  Fly   110 PGPSPTSSAVGAGGISGKDLLKLKEPMRVGFYD----IERTIGKGNFAVVKLARHRITKNEVAIK 170

  Fly   106 IISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKF 170
            ||.|.:......|| :.||:|.:|.|.|.::|..||.:||.:.:|::.:.|..|.:.||:.:...
  Fly   171 IIDKSQLDQTNLQK-VYREVEIMKRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGR 234

  Fly   171 LDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILS 235
            :.|..:|..|.|::|||||.|.||:||||:|.||||||.|.|:|:.||||:.......     |.
  Fly   235 MSESAARFKFWQIISAVEYCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGE-----LL 294

  Fly   236 KTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKS 300
            .|:|||..||:||:.:|..|.....|||:.|||.|.:|.|.||:|||.:..|..|: .|..|...
  Fly   295 ATWCGSPPYAAPEVFEGKQYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRV-LSGRFRIP 358

  Fly   301 PSASSECKHMI--MHILAPVKIRYNIPQVKEDPWYSP 335
            ...||||:|:|  |.:|.|.: ||.|.|:|...|..|
  Fly   359 FFMSSECEHLIRRMLVLEPTR-RYTIDQIKRHRWMCP 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 104/259 (40%)
S_TKc 78..332 CDD:214567 104/255 (41%)
Sik2NP_569972.1 STKc_SIK 140..392 CDD:270973 104/263 (40%)
S_TKc 141..392 CDD:214567 104/262 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.