DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and LOC301165

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_008765012.1 Gene:LOC301165 / 301165 RGDID:1564986 Length:512 Species:Rattus norvegicus


Alignment Length:277 Identity:92/277 - (33%)
Similarity:147/277 - (53%) Gaps:22/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KPQKTILE-EHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISK-VKAPSEYTQKFLPREIEA 127
            :.:..||| :..|:|.  :|:|:|.:||:......|.|||||::.| :.:.::.|     .|:|.
  Rat     4 RTEVNILEKDFRILLS--LGSGSYGEVKLACHLPTGTRVAVKVLDKNINSVADIT-----LEVEL 61

  Fly   128 VKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHS 192
            ::.|.|.|::.|:..|:|....::||:......|...:|....:.|.::|.:|:|:||||.::|.
  Rat    62 LQSLEHRNIVRFFHMIDTLTASFIIMEYVAGEDLESCLRSLGCMKEEEARPIFQQVVSAVHFLHQ 126

  Fly   193 KGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDP 257
            :.:.|||||.||:|:|...|.||.|||.|.|.|   :.|::  :..|||..|.:||||....||.
  Rat   127 RRIAHRDIKLENILVDAAGNAKLCDFGMAIKIT---EGQML--EEICGSLLYWAPEILARKPYDG 186

  Fly   258 FMSDIWACGVVCYAMVFGRLPY---DGSNVHILLKRINQSLVFPKSPSASSECKHMIMHIL-APV 318
            ...|:|:.|:|.|.:|.|..||   ...::|    |:..:.:.|.....|..|..:|..:| .|.
  Rat   187 LAGDMWSLGIVLYVLVTGHFPYLEATTEDMH----RLITTTMCPIPYHLSKPCHIIIARLLMVPT 247

  Fly   319 KIRYNIPQVKEDPWYSP 335
            ..|..|.|:.|.||..|
  Rat   248 WYRLTIYQLVERPWLGP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 87/262 (33%)
S_TKc 78..332 CDD:214567 85/258 (33%)
LOC301165XP_008765012.1 PKc_like 13..261 CDD:419665 86/263 (33%)
UBA_like_SF 278..316 CDD:419673
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.