DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Tssk6

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001099548.1 Gene:Tssk6 / 290670 RGDID:1559764 Length:273 Species:Rattus norvegicus


Alignment Length:268 Identity:106/268 - (39%)
Similarity:164/268 - (61%) Gaps:12/268 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHE 134
            :|.|.|..||:.||.|:|:|||:..|::|...||:|::.:.:||.::..||||||:..::|:.|.
  Rat     6 LLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHP 70

  Fly   135 NLITFYQSIETSH-RVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHR 198
            :::..::.||..: ::|::|:.|.. .||..|:....:...|:|.||.|:..||.|:|...:|||
  Rat    71 HIVHVFEFIEVCNGKLYIVMEAAAT-DLLQAVQRNGRIPGSQARELFSQIAGAVRYLHDHHLVHR 134

  Fly   199 DIKCENLLL--DENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSD 261
            |:||||:||  ||. .:||.||||.|:.....|    ||.|:|||.||||||:|.|:.|||...|
  Rat   135 DLKCENVLLSPDER-RVKLTDFGFGRQAHGYPD----LSTTYCGSAAYASPEVLLGIPYDPKKYD 194

  Fly   262 IWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKSPSASSECKHMIMHIL--APVKIRYNI 324
            :|:.|||.|.||.|.:|:|.|::..|.:|..:.:::|.....|..||.:|..:|  :| ..|.:.
  Rat   195 VWSLGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPDGLELSERCKSLIAELLQFSP-SARPSA 258

  Fly   325 PQVKEDPW 332
            .||..:.|
  Rat   259 GQVARNGW 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 104/263 (40%)
S_TKc 78..332 CDD:214567 102/258 (40%)
Tssk6NP_001099548.1 STKc_TSSK6-like 11..267 CDD:271066 104/263 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X507
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.