DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and TSSK4

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001171668.1 Gene:TSSK4 / 283629 HGNCID:19825 Length:338 Species:Homo sapiens


Alignment Length:288 Identity:116/288 - (40%)
Similarity:175/288 - (60%) Gaps:27/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 TILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHH 133
            ::::|:|..:||.||.|:|..|...|..:....||||||||.||..:|..|||||||:.:|.|.|
Human    18 SLMDEYGYEVGKAIGHGSYGSVYEAFYTKQKVMVAVKIISKKKASDDYLNKFLPREIQVMKVLRH 82

  Fly   134 ENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVH- 197
            :.||.||::||::.|||:|::||:.|.:|::::......||.:...|.||...:.|:|||.:|| 
Human    83 KYLINFYRAIESTSRVYIILELAQGGDVLEWIQRYGACSEPLAGKWFSQLTLGIAYLHSKSIVHR 147

  Fly   198 ---------RDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVI--------------LSKTFC 239
                     ||:|.||||||:..|:|:.|||||:   ....||.:              ||:|:|
Human   148 LMPSLSAAGRDLKLENLLLDKWENVKISDFGFAK---MVPSNQPVGCSPSYRQVNCFSHLSQTYC 209

  Fly   240 GSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKSPSAS 304
            ||:|||.||||:|:.|:||:||.|:.||:.|.:|...||:|.:|:..||:...:.:.||.:.:.|
Human   210 GSFAYACPEILRGLPYNPFLSDTWSMGVILYTLVVAHLPFDDTNLKKLLRETQKEVTFPANHTIS 274

  Fly   305 SECKHMIMHILAPVKIRYNIPQVKEDPW 332
            .|||::|:.:|.....|..|..:.:|.|
Human   275 QECKNLILQMLRQATKRATILDIIKDSW 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 115/282 (41%)
S_TKc 78..332 CDD:214567 113/277 (41%)
TSSK4NP_001171668.1 STKc_TSSK4-like 24..303 CDD:271064 115/282 (41%)
S_TKc 25..303 CDD:214567 114/281 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147815
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9I8
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H57078
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2007
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103794
Panther 1 1.100 - - LDO PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.660

Return to query results.
Submit another query.