DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and par-1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster


Alignment Length:301 Identity:110/301 - (36%)
Similarity:162/301 - (53%) Gaps:34/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PSGVVPVKADDKSKPQKTI----------LEEHGIILG-----KVIGTGNYAKVKIGFSEEYGKR 101
            ||.:....:..|..|...:          .|||   :|     |.||.||:||||:......||.
  Fly   217 PSAIKQRTSSAKGSPNMQMRSSAPMRWRATEEH---IGKYKLIKTIGKGNFAKVKLAKHLPTGKE 278

  Fly   102 VAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVR 166
            ||:|||.|.:......|| |.||:..:|.|.|.|::..:|.|||...:||||:.|..|.:.||:.
  Fly   279 VAIKIIDKTQLNPGSLQK-LFREVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLV 342

  Fly   167 ERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQ 231
            ....:.|.::|..|:|:||||:|.|.|.::|||:|.||||||...|:|:.||||:.:.|..|.  
  Fly   343 LHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGSK-- 405

  Fly   232 VILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRI---NQ 293
               ..|||||..||:||:.:|..||....|:|:.||:.|.:|.|.||:|||.:..|.:|:   ..
  Fly   406 ---LDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKY 467

  Fly   294 SLVFPKSPSASSECKHMIMH--ILAPVKIRYNIPQVKEDPW 332
            .:.|    ..|::|::::..  :|.|.| |.::..:..|.|
  Fly   468 RIPF----YMSTDCENLLRKFLVLNPAK-RASLETIMGDKW 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 103/268 (38%)
S_TKc 78..332 CDD:214567 102/263 (39%)
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 102/263 (39%)
S_TKc 253..504 CDD:214567 102/262 (39%)
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.