DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Smok2a

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_038769.1 Gene:Smok2a / 27263 MGIID:1351487 Length:504 Species:Mus musculus


Alignment Length:280 Identity:97/280 - (34%)
Similarity:153/280 - (54%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KSKPQKTILEEHGI---ILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPRE 124
            :|||..:.:|....   :|| .||.|...|||:......|..||||:|.|    .||..|.|..|
Mouse    13 RSKPPFSEMENFHAQYEMLG-TIGHGGSTKVKLARHRLTGTHVAVKMIPK----REYWCKPLMSE 72

  Fly   125 IEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEY 189
            .|.:....|.|:|:..|.|||..:|||||:|.|..:|..::|...:|.|.::|.|||||:||:.|
Mouse    73 AELLMMADHPNIISLLQVIETKKKVYLIMELCEGKSLYQHIRNAGYLQEDEARALFKQLLSAINY 137

  Fly   190 IHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVA 254
            .|::|:||||:|.:|::::::..:|:||||..   .:....|.:  ..|||:|.:::||:|....
Mouse   138 CHNQGIVHRDLKPDNIMVEKDGRVKIIDFGLG---IQVKPGQKL--NLFCGTYPFSAPEVLLSRP 197

  Fly   255 YDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKSPSASSECK------HMIMH 313
            ||....|:|..|||.|.||.|::|:|.:::..|.|:|       .:...|..|:      |:|..
Mouse   198 YDGPKIDVWTLGVVLYFMVTGKIPFDAASIEKLRKQI-------VAGKYSVPCRLSVKLHHLITL 255

  Fly   314 ILAP-VKIRYNIPQVKEDPW 332
            ::.. .::|..:.:|...||
Mouse   256 LMTDNPELRPTVAEVMMHPW 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 93/268 (35%)
S_TKc 78..332 CDD:214567 91/260 (35%)
Smok2aNP_038769.1 STKc_AMPK-like 27..275 CDD:270905 91/264 (34%)
S_TKc 28..276 CDD:214567 93/265 (35%)
UBA_MARK_Par1 295..334 CDD:270522
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 376..403
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..469
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.