DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and kin1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_596106.1 Gene:kin1 / 2540792 PomBaseID:SPBC4F6.06 Length:891 Species:Schizosaccharomyces pombe


Alignment Length:364 Identity:105/364 - (28%)
Similarity:176/364 - (48%) Gaps:72/364 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SPRRKNDQGGVIGASSSQDLVTDQNSGRRQEQKVYTFSDRPPQPKPPAPSGV------VPV---- 58
            ||..::...|.:.:.||:                        :|.|.:||..      |||    
pombe    68 SPSSQSPHHGPVRSPSSR------------------------KPLPASPSRTRDHSLRVPVSGHS 108

  Fly    59 -KADDKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKII---------SKVKAP 113
             .||:|.:.::.::..:  :|||.||.|:..|||:....:.|::.|:||:         :|..|.
pombe   109 YSADEKPRERRKVIGNY--VLGKTIGAGSMGKVKVAHHLKTGEQFAIKIVTRLHPDITKAKAAAS 171

  Fly   114 SEYT---QKFLPREIEAVKG------LHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERK 169
            :|.|   |....:||..|:.      |.|..:........|:...|::.:..:.|.:|||:....
pombe   172 AEATKAAQSEKNKEIRTVREAALSTLLRHPYICEARDVYITNSHYYMVFEFVDGGQMLDYIISHG 236

  Fly   170 FLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFA---RKDTRTSDNQ 231
            .|.|.|:|...:|:.||:.|:|...|||||:|.||:|:.:..::|:||||.:   |:.:|.    
pombe   237 KLKEKQARKFVRQIGSALSYLHQNSVVHRDLKIENILISKTGDIKIIDFGLSNLYRRQSRL---- 297

  Fly   232 VILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLV 296
                :|||||..:|:||:|....|.....|:|:.|:|.|.:|.|::|:|..|:..|..:|.:..|
pombe   298 ----RTFCGSLYFAAPELLNAQPYIGPEVDVWSFGIVLYVLVCGKVPFDDQNMSALHAKIKKGTV 358

  Fly   297 FPKSPS-ASSECKHMIMHILA--PVKIRYNIPQVKEDPW 332
              :.|| .||:||.::..:|.  |:| |..:.:|...||
pombe   359 --EYPSYLSSDCKGLLSRMLVTDPLK-RATLEEVLNHPW 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 90/282 (32%)
S_TKc 78..332 CDD:214567 88/277 (32%)
kin1NP_596106.1 STKc_Kin1_2 123..395 CDD:270979 90/285 (32%)
S_TKc 125..395 CDD:214567 90/283 (32%)
MARK_C_like 753..889 CDD:213377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.