DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Tssk1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_033461.2 Gene:Tssk1 / 22114 MGIID:1347557 Length:365 Species:Mus musculus


Alignment Length:273 Identity:125/273 - (45%)
Similarity:181/273 - (66%) Gaps:11/273 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHE 134
            :|:..|.|:|..:|.|:|||||..:||.....||||||.:.||||::.:||||||||.:..|:|.
Mouse     6 VLKRRGYIMGINLGEGSYAKVKSAYSERLKFNVAVKIIDRKKAPSDFLEKFLPREIEILAMLNHR 70

  Fly   135 NLITFYQSIETSH-RVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHR 198
            :::..|:..|||. :||::|:|...|.||::::.|..|.|..:|..|.||.||::|.|...||||
Mouse    71 SIVKTYEIFETSDGKVYIVMELGVQGDLLEFIKTRGALQEDDARKKFHQLSSAIKYCHDLDVVHR 135

  Fly   199 DIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIW 263
            |:||||||||:::|:||.||||:::..|....::|||||||||.|||:||:|:|:.|.|.:.|||
Mouse   136 DLKCENLLLDKDFNIKLSDFGFSKRCLRDDSGRLILSKTFCGSAAYAAPEVLQGIPYQPKVYDIW 200

  Fly   264 ACGVVCYAMVFGRLPYDGSNVHILLK-----RINQSLVFPKSPSASSECKHMIMHILAP-VKIRY 322
            :.||:.|.||.|.:|||.||:..:|:     |:|    ||:|...:.|||.:|..:|.| |..|.
Mouse   201 SLGVILYIMVCGSMPYDDSNIKKMLRIQKEHRVN----FPRSKHLTGECKDLIYRMLQPDVNRRL 261

  Fly   323 NIPQVKEDPWYSP 335
            :|.::....|..|
Mouse   262 HIDEILNHCWVQP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 122/264 (46%)
S_TKc 78..332 CDD:214567 120/260 (46%)
Tssk1NP_033461.2 STKc_TSSK1_2-like 10..271 CDD:271067 122/264 (46%)
S_TKc 12..272 CDD:214567 121/263 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..365
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 1 1.000 - - FOG0007569
OrthoInspector 1 1.000 - - otm43332
orthoMCL 1 0.900 - - OOG6_103794
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.