DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and F23C8.8

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_490976.1 Gene:F23C8.8 / 171802 WormBaseID:WBGene00017737 Length:301 Species:Caenorhabditis elegans


Alignment Length:274 Identity:86/274 - (31%)
Similarity:142/274 - (51%) Gaps:40/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PAPSGVVPV---KADDKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVK 111
            |:...::|:   .......|:......|.::.          ||.   |:.|.:.|.|||:.:..
 Worm     8 PSTEKLIPIIGLSVSGTFSPRPIATTAHSVVF----------KVD---SQLYRREVIVKIVDRKS 59

  Fly   112 APSEYTQKFLPREIEAVKGLHHENL---ITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDE 173
            .|:...:||.|||:|....:.|.::   :...:...|  :..:|....|.||||:::.::|.|.|
 Worm    60 IPANVAEKFFPRELEITMKVRHPHIARCLAITRPAPT--KFVIISDYYERGTLLEWILQKKRLKE 122

  Fly   174 -PQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKT 237
             |.:.|||:||:.|:.|:|.:|:||||:|.||:|:|.|.::|||||||||...|..     .|::
 Worm   123 HPLAATLFRQLIEAINYLHKRGIVHRDVKLENILIDGNGDIKLIDFGFARHIERRE-----RSRS 182

  Fly   238 FCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKS-P 301
            |||:..|..|:|.|...|:.:.:|.:|||:|.:.||.|:.|....|.:|          :|:. |
 Worm   183 FCGTQPYTCPQITKYRPYEAYAADYYACGIVLFTMVTGKWPNMTENPNI----------YPEGYP 237

  Fly   302 SASSECKHMIMHIL 315
            |.|  |:.::..:|
 Worm   238 SRS--CRKLVSSLL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 82/246 (33%)
S_TKc 78..332 CDD:214567 82/243 (34%)
F23C8.8NP_490976.1 PKc_like 46..268 CDD:389743 79/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159777
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.800

Return to query results.
Submit another query.