DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Snrk

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_620188.1 Gene:Snrk / 170837 RGDID:69653 Length:746 Species:Rattus norvegicus


Alignment Length:263 Identity:90/263 - (34%)
Similarity:143/263 - (54%) Gaps:20/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQS 142
            |.|.:|.|::|.||:......|::||||:|.|.|..:..| ..|.:|:..:|.:.|.|::..|:.
  Rat    18 LDKTLGRGHFAVVKLARHVFTGEKVAVKVIDKTKLDTLAT-GHLFQEVRCMKLVQHPNIVRLYEV 81

  Fly   143 IETSHRVYLIMQLAENGTLLDYV-RERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLL 206
            |:|..::|||::|.:.|.:.||: :..:.|:|..::..|.|:|.|:.|.|...|||||:|.||::
  Rat    82 IDTQTKLYLILELGDGGDMFDYIMKHEEGLNEDLAKKYFAQIVHAISYCHKLHVVHRDLKPENVV 146

  Fly   207 LDENWNL-KLIDFGFAR-----KDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWAC 265
            ..|...| ||.||||:.     |...||          |||.||::||||.|..||....|||:.
  Rat   147 FFEKQGLVKLTDFGFSNKFQPGKKLTTS----------CGSLAYSAPEILLGDEYDAPAVDIWSL 201

  Fly   266 GVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKSPSASSECKHMIMHIL-APVKIRYNIPQVKE 329
            ||:.:.:|.|:.|:..:|....|..| ....:...|..|:.|:.:|..:| ...|.|.::.:::.
  Rat   202 GVILFMLVCGQPPFQEANDSETLTMI-MDCKYTVPPRVSAGCRDLITRMLQRDPKRRASLEEIES 265

  Fly   330 DPW 332
            .||
  Rat   266 HPW 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 90/263 (34%)
S_TKc 78..332 CDD:214567 88/261 (34%)
SnrkNP_620188.1 STKc_SNRK 12..269 CDD:270976 90/263 (34%)
UBA_SNRK 288..335 CDD:270524
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 494..638
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.