DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and LOC100911229

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_038951080.1 Gene:LOC100911229 / 100911229 RGDID:6494469 Length:654 Species:Rattus norvegicus


Alignment Length:248 Identity:81/248 - (32%)
Similarity:131/248 - (52%) Gaps:21/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DDKSKP-QKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPRE 124
            |.:|.| |:..|.:|..||.. :|.|.:.:||:........:||:|::     |.......|..|
  Rat     9 DLRSSPFQEDALTDHYRILAS-LGQGGFGEVKLASHLLTQTKVAIKVL-----PKSNKNLLLKSE 67

  Fly   125 IEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEY 189
            ||.:|.|.|.::|.....|:|:..::::::.|..|.||..:.:..:|.|.:...||:|:|.|::|
  Rat    68 IEIMKSLDHPHIIKLLHIIDTNENIFIVLEHAVGGELLTRIEDFGYLPEEECNRLFRQMVLALQY 132

  Fly   190 IHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSK---TFCGSYAYASPEILK 251
            .|.:|::|||||.||:|||...|:||.|||.:.|        :::.:   |.||:..|.:||:..
  Rat   133 CHQRGIIHRDIKPENILLDHKGNVKLSDFGLSTK--------IVMGQKLTTLCGTLPYCAPELFN 189

  Fly   252 GVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRI---NQSLVFPKSP 301
            ...||....|:|:.|||.|.|..|.||:.|.....:.::|   ..|:.|..||
  Rat   190 LNGYDGQAIDVWSLGVVLYYMATGCLPFQGFTYQAIKQKILSGRYSVNFRLSP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 75/233 (32%)
S_TKc 78..332 CDD:214567 74/230 (32%)
LOC100911229XP_038951080.1 STKc_AMPK-like 23..270 CDD:270905 76/234 (32%)
UBA_MARK_Par1 290..329 CDD:270522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.