DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and nuak2

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001121499.1 Gene:nuak2 / 100158605 XenbaseID:XB-GENE-5857794 Length:570 Species:Xenopus tropicalis


Alignment Length:236 Identity:87/236 - (36%)
Similarity:140/236 - (59%) Gaps:8/236 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIE 144
            :.:|.|.|.:||.. .:..|:.||:|.|.|.:...|.....:.||.|.:..|.|.::|:.|:..|
 Frog    30 ETLGKGTYGRVKRA-RDSQGREVAIKSIRKDRIKDEQDMLHIRRETEIMSSLCHPHIISIYEVFE 93

  Fly   145 TSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDE 209
            .|.::.::|:.|..|.|.||:.||:.|.:.::|..|:|:||||:|.|:.|:||||:|.||:||||
 Frog    94 NSSKIVIVMEYASQGDLYDYISERQRLSDHEARRFFRQIVSAVQYCHANGIVHRDLKLENILLDE 158

  Fly   210 NWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVF 274
            |.|:|:.|||.:  :...|::.:   :|:|||..||||||:.|..|.....|.|:.||:.|.:|.
 Frog   159 NKNVKIADFGLS--NIYNSESYL---QTYCGSPLYASPEIVNGRPYVGPEVDSWSLGVLLYILVH 218

  Fly   275 GRLPYDGSNVHILLKRINQSLVFPKSPSASSECKHMIMHIL 315
            |.:|:||.:...|:.:|:....  |.|:..|:...:|..:|
 Frog   219 GCMPFDGQDYKKLVAQISSGAY--KEPTHPSDACGLIRWLL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 87/236 (37%)
S_TKc 78..332 CDD:214567 87/236 (37%)
nuak2NP_001121499.1 PKc_like 22..276 CDD:304357 87/236 (37%)
S_TKc 26..276 CDD:214567 87/236 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.