DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and hunk

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_031751566.1 Gene:hunk / 100145703 XenbaseID:XB-GENE-968418 Length:731 Species:Xenopus tropicalis


Alignment Length:271 Identity:103/271 - (38%)
Similarity:152/271 - (56%) Gaps:29/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSE-YTQKFLPREIEAVKGLHHENLITFY 140
            ::|:.:|.|::|||:.|.....|::||:|:|.|.||..: |..|.|.||.:..:.:.|.|:....
 Frog    90 LIGRKLGEGSFAKVREGLHVGTGEKVAIKVIDKKKAKKDTYVTKNLRREGQIQQMIRHPNITQLL 154

  Fly   141 QSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENL 205
            ..:||.:..||:|:|...|.|:..:.|||.::|.::|...:||:.|||::|..||||||:|.|||
 Frog   155 DILETENSYYLVMELCTGGNLMHKIYERKRIEEHEARKYIRQLILAVEHLHRAGVVHRDLKIENL 219

  Fly   206 LLDENWNLKLIDFGFARKDTRTSDNQVILS-----KTFCGSYAYASPEILKGVAYDPFMSDIWAC 265
            |||||.|:||||||.       |:...||.     .|.|||.|||:||:|....|.|.: |:|:.
 Frog   220 LLDENNNIKLIDFGL-------SNCAGILGYTDPFSTQCGSPAYAAPELLARKKYGPKV-DVWSI 276

  Fly   266 GVVCYAMVFGRLPYDGSNVHILLKRINQSLV------FPK--SPSASSECKHMIMHILAPVKI-R 321
            ||..|||:.|.||:  :.....|:.:.|.:|      .|.  ||:|.|    .:..:|.|..: |
 Frog   277 GVNMYAMLTGTLPF--TVEPFSLRALYQKMVDKDMNPLPTHLSPAAIS----FLRSLLEPDPLKR 335

  Fly   322 YNIPQVKEDPW 332
            .||.|...:.|
 Frog   336 PNIQQALANRW 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 103/271 (38%)
S_TKc 78..332 CDD:214567 102/268 (38%)
hunkXP_031751566.1 PKc_like 86..347 CDD:419665 103/271 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.