DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and prkaa1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001120434.1 Gene:prkaa1 / 100145520 XenbaseID:XB-GENE-946195 Length:551 Species:Xenopus tropicalis


Alignment Length:277 Identity:104/277 - (37%)
Similarity:160/277 - (57%) Gaps:11/277 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ADDKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPRE 124
            |.||.|.....::....|||..:|.|.:.|||:|..|..|.:|||||:::.|..|......:.||
 Frog     2 AADKQKHHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRRE 66

  Fly   125 IEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEY 189
            |:.:|...|.::|..||.|.|...::::|:....|.|.||:.:...|||.:||.||:|::|.|:|
 Frog    67 IQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLDEKESRRLFQQILSGVDY 131

  Fly   190 IHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVA 254
            .|...|||||:|.||:|||.:.|.|:.|||.:   ...:|.:.:  :|.|||..||:||::.|..
 Frog   132 CHRHMVVHRDLKPENVLLDAHMNAKIADFGLS---NMMADGEFL--RTSCGSPNYAAPEVISGRL 191

  Fly   255 YDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVF-PK--SPSASSECKHMIMHILA 316
            |.....|||:|||:.||::.|.||:|..:|..|.|:|...:.: |:  :|...|..|||:  ::.
 Frog   192 YAGPEVDIWSCGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPPVISLLKHML--LVD 254

  Fly   317 PVKIRYNIPQVKEDPWY 333
            |:| |..|..::|..|:
 Frog   255 PMK-RATIKDIREHEWF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 99/260 (38%)
S_TKc 78..332 CDD:214567 98/256 (38%)
prkaa1NP_001120434.1 STKc_AMPK_alpha 15..270 CDD:270981 99/262 (38%)
S_TKc 18..270 CDD:214567 99/259 (38%)
UBA_AID_AAPK1 287..351 CDD:270586
AMPKA1_C 396..549 CDD:213384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.