DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tctn and B9D2

DIOPT Version :9

Sequence 1:NP_608998.2 Gene:tctn / 33866 FlyBaseID:FBgn0261697 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_085055.2 Gene:B9D2 / 80776 HGNCID:28636 Length:175 Species:Homo sapiens


Alignment Length:108 Identity:27/108 - (25%)
Similarity:39/108 - (36%) Gaps:27/108 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 PTSGPLGY-------------LSGAPVILSRMLPQNSSEDKQLISYHSLN-QNIKEFHWLSLPSR 441
            |..|.:.|             |.|.|.:..::..|:|....||..|...: .:....|.|:.|:.
Human    49 PQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTW 113

  Fly   442 KPRGS---SCQRA-------LDHKEALRFGIDLLTRCELRHAA 474
            :|.||   ...||       |.|.:.:..|.|   |..|..||
Human   114 RPLGSWREQLARAFVGGGPQLLHGDTIYSGAD---RYRLHTAA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tctnNP_608998.2 DUF1619 117..403 CDD:285068 5/24 (21%)
B9D2NP_085055.2 B9-C2 10..163 CDD:284557 27/108 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.