DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tctn and B9d2

DIOPT Version :10

Sequence 1:NP_608998.2 Gene:tctn / 33866 FlyBaseID:FBgn0261697 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001100964.1 Gene:B9d2 / 308443 RGDID:1566122 Length:175 Species:Rattus norvegicus


Alignment Length:108 Identity:27/108 - (25%)
Similarity:39/108 - (36%) Gaps:27/108 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 PTSGPLGY-------------LSGAPVILSRMLPQNSSEDKQLISYHSLN-QNIKEFHWLSLPSR 441
            |.:|.:.|             |.|.|.:..::..|:|....||..|...: .:....|.|..|:.
  Rat    49 PQTGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTW 113

  Fly   442 KPRGS---SCQRA-------LDHKEALRFGIDLLTRCELRHAA 474
            :|.||   ...||       |.|.:.:..|.|   |..|..||
  Rat   114 RPLGSWREQLARAFVGGGPQLLHADTIYSGAD---RYRLHTAA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tctnNP_608998.2 Herpes_BLLF1 <33..>112 CDD:282904
TCTN_DUF1619 117..403 CDD:462260 5/24 (21%)
B9d2NP_001100964.1 B9-C2 4..159 CDD:462108 27/108 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.