DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tctn and mksr-2

DIOPT Version :9

Sequence 1:NP_608998.2 Gene:tctn / 33866 FlyBaseID:FBgn0261697 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_500186.1 Gene:mksr-2 / 189676 WormBaseID:WBGene00021416 Length:175 Species:Caenorhabditis elegans


Alignment Length:162 Identity:33/162 - (20%)
Similarity:49/162 - (30%) Gaps:63/162 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 GWLCVFRSNTKATKT------------QPPDMNIDTSQYRKWKDNLEYQESDYAQSRPSAGHYKF 228
            ||..|...:...|:|            .|.|:::.||..:.|...|                   
 Worm    32 GWRVVQGESEGQTQTDCPSVFENAHFAHPIDLHLATSSIQGWPRLL------------------- 77

  Fly   229 GQTLQLW------QPETKQLATLELPAAYESPNCQLKQSVWHLQPIRHV----CRMKDSAQLQES 283
               ||:|      :.|.....||.||.:                |.:||    |.....:..:|.
 Worm    78 ---LQIWHHDNYGRQEIAGYGTLLLPTS----------------PGKHVLTSGCWRPKGSWREEM 123

  Fly   284 IWSLLNQTSNYEILSKPRDLEEPEVNGLIVQV 315
            :..|:........||.   ||:|.:...||.|
 Worm   124 MHKLVGGGLQLTSLSA---LEDPSIREKIVSV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tctnNP_608998.2 DUF1619 117..403 CDD:285068 33/162 (20%)
mksr-2NP_500186.1 B9-C2 10..163 CDD:284557 33/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.