DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tctn and mksr-2

DIOPT Version :10

Sequence 1:NP_608998.2 Gene:tctn / 33866 FlyBaseID:FBgn0261697 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_500186.1 Gene:mksr-2 / 189676 WormBaseID:WBGene00021416 Length:175 Species:Caenorhabditis elegans


Alignment Length:162 Identity:33/162 - (20%)
Similarity:49/162 - (30%) Gaps:63/162 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 GWLCVFRSNTKATKT------------QPPDMNIDTSQYRKWKDNLEYQESDYAQSRPSAGHYKF 228
            ||..|...:...|:|            .|.|:::.||..:.|...|                   
 Worm    32 GWRVVQGESEGQTQTDCPSVFENAHFAHPIDLHLATSSIQGWPRLL------------------- 77

  Fly   229 GQTLQLW------QPETKQLATLELPAAYESPNCQLKQSVWHLQPIRHV----CRMKDSAQLQES 283
               ||:|      :.|.....||.||.:                |.:||    |.....:..:|.
 Worm    78 ---LQIWHHDNYGRQEIAGYGTLLLPTS----------------PGKHVLTSGCWRPKGSWREEM 123

  Fly   284 IWSLLNQTSNYEILSKPRDLEEPEVNGLIVQV 315
            :..|:........||.   ||:|.:...||.|
 Worm   124 MHKLVGGGLQLTSLSA---LEDPSIREKIVSV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tctnNP_608998.2 Herpes_BLLF1 <33..>112 CDD:282904
TCTN_DUF1619 117..403 CDD:462260 33/162 (20%)
mksr-2NP_500186.1 B9-C2 4..164 CDD:462108 33/162 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.