DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tctn and B9d2

DIOPT Version :9

Sequence 1:NP_608998.2 Gene:tctn / 33866 FlyBaseID:FBgn0261697 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001188704.1 Gene:B9d2 / 10178891 FlyBaseID:FBgn0261683 Length:177 Species:Drosophila melanogaster


Alignment Length:176 Identity:34/176 - (19%)
Similarity:54/176 - (30%) Gaps:66/176 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 YCQ-GLQA-QIWSL----------LLPHNCTQLEDVTKVFVSHLGRPQPDKW--LPMEVRYPENV 536
            ||: .||: ..|.|          :..|......|..:....||.......|  |.:|| |..||
  Fly    22 YCKWSLQSGNAWRLVQGEVQGQSHVASHRLQSSSDFAQPLDIHLSTASVQGWPRLLVEV-YAVNV 85

  Fly   537 HEMPPPVQAVYDEMRQSLSCRNIFLSVGYEFHVAHLAMVEGRAPHQRVLQHARLVLGQRHDLEFD 601
            .:...|                    |||.|  .|:....|                 .|.||..
  Fly    86 LQQSWP--------------------VGYGF--VHVPSTPG-----------------THRLEIG 111

  Fly   602 TSEIEVALPLSISAMFYRMQTKALSNGAAVGIAGHLVLVEMIYLGI 647
            |.::      :.:.::..::.:....|||      |...:::|.|:
  Fly   112 TWKV------APNGLWQSLRERFGGGGAA------LSKTDLLYSGV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tctnNP_608998.2 DUF1619 117..403 CDD:285068
B9d2NP_001188704.1 B9-C2 4..165 CDD:399858 34/176 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4028
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.