DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc4 and ARC19

DIOPT Version :9

Sequence 1:NP_608996.1 Gene:Arpc4 / 33864 FlyBaseID:FBgn0284255 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_012912.1 Gene:ARC19 / 853856 SGDID:S000001496 Length:171 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:112/169 - (66%)
Similarity:138/169 - (81%) Gaps:1/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATLKPYLTAVRHSLTAAMCLQDFPSQVVERHNKPEVEI-CSSKELVLTPVVVSRNEREKVLIE 64
            |:.:|:|||||||:||.||:.|.:|.||.|||||:||||: .:|.||:|.|:.:||||.|:||||
Yeast     1 MSQSLRPYLTAVRYSLEAALTLSNFSSQEVERHNRPEVEVPNTSAELLLQPMHISRNENEQVLIE 65

  Fly    65 PSINSVRVSIAVKQADEIERILCHKFTRFMMRRAESFVILRRKPIEGYDISFLITNFHTEQMYKH 129
            ||:||||:|:.||||||||:||.||||||:.:|||:|.||||.||.||.|||||||.|||.|...
Yeast    66 PSVNSVRMSLMVKQADEIEQILVHKFTRFLEQRAEAFYILRRVPIPGYSISFLITNKHTESMKTG 130

  Fly   130 KLVDFVISFMEEIDKEISEMKLAVNARARTCAEEFLKRF 168
            |||||:|.|||::||||||:||.:|||||..||.:|..|
Yeast   131 KLVDFIIEFMEDVDKEISEIKLFLNARARFVAEAYLDEF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc4NP_608996.1 ARPC4 1..166 CDD:399097 110/165 (67%)
ARC19NP_012912.1 ARPC4 1..166 CDD:399097 110/164 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346207
Domainoid 1 1.000 215 1.000 Domainoid score I482
eggNOG 1 0.900 - - E1_KOG1876
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4177
Inparanoid 1 1.050 217 1.000 Inparanoid score I788
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53638
OrthoFinder 1 1.000 - - FOG0003327
OrthoInspector 1 1.000 - - oto99727
orthoMCL 1 0.900 - - OOG6_102934
Panther 1 1.100 - - LDO PTHR22629
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R90
SonicParanoid 1 1.000 - - X2219
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.