DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc4 and arpc4

DIOPT Version :9

Sequence 1:NP_608996.1 Gene:Arpc4 / 33864 FlyBaseID:FBgn0284255 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001004844.1 Gene:arpc4 / 448127 XenbaseID:XB-GENE-490534 Length:168 Species:Xenopus tropicalis


Alignment Length:168 Identity:140/168 - (83%)
Similarity:153/168 - (91%) Gaps:0/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATLKPYLTAVRHSLTAAMCLQDFPSQVVERHNKPEVEICSSKELVLTPVVVSRNEREKVLIEP 65
            |.|||:|||.|||.:|.||:||::|.|||||||||||||:.|||||:|.|||:||||:||||||.
 Frog     1 MTATLRPYLNAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVVISRNEKEKVLIEG 65

  Fly    66 SINSVRVSIAVKQADEIERILCHKFTRFMMRRAESFVILRRKPIEGYDISFLITNFHTEQMYKHK 130
            ||||||||||||||||||:||||||.||||.|||:|.||||||:|||||||||||||||||||||
 Frog    66 SINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHK 130

  Fly   131 LVDFVISFMEEIDKEISEMKLAVNARARTCAEEFLKRF 168
            ||||||.||||||||||||||:||||||..||||||.|
 Frog   131 LVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc4NP_608996.1 ARPC4 1..166 CDD:399097 137/164 (84%)
arpc4NP_001004844.1 ARPC4 1..166 CDD:399097 137/164 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 272 1.000 Domainoid score I1772
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4177
Inparanoid 1 1.050 273 1.000 Inparanoid score I2921
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1351067at2759
OrthoFinder 1 1.000 - - FOG0003327
OrthoInspector 1 1.000 - - oto104026
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2219
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.