DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc4 and arpc4l

DIOPT Version :9

Sequence 1:NP_608996.1 Gene:Arpc4 / 33864 FlyBaseID:FBgn0284255 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001003762.1 Gene:arpc4l / 445305 ZFINID:ZDB-GENE-040808-18 Length:168 Species:Danio rerio


Alignment Length:168 Identity:139/168 - (82%)
Similarity:153/168 - (91%) Gaps:0/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATLKPYLTAVRHSLTAAMCLQDFPSQVVERHNKPEVEICSSKELVLTPVVVSRNEREKVLIEP 65
            |.|||:|||.|||.:|.||:||::|.|||||||||||||:.|||||:|.|||:|||::||||||.
Zfish     1 MTATLRPYLNAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVVISRNDKEKVLIEG 65

  Fly    66 SINSVRVSIAVKQADEIERILCHKFTRFMMRRAESFVILRRKPIEGYDISFLITNFHTEQMYKHK 130
            ||||||||||||||||||:||||||.||||.|||:|.||||||:|||||||||||||||||||||
Zfish    66 SINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHK 130

  Fly   131 LVDFVISFMEEIDKEISEMKLAVNARARTCAEEFLKRF 168
            ||||||.||||||||||||||:||||||..||||||.|
Zfish   131 LVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc4NP_608996.1 ARPC4 1..166 CDD:399097 136/164 (83%)
arpc4lNP_001003762.1 ARPC4 1..166 CDD:399097 136/164 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595020
Domainoid 1 1.000 271 1.000 Domainoid score I1772
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4177
Inparanoid 1 1.050 274 1.000 Inparanoid score I2941
OMA 1 1.010 - - QHG53638
OrthoDB 1 1.010 - - D1351067at2759
OrthoFinder 1 1.000 - - FOG0003327
OrthoInspector 1 1.000 - - otm25910
orthoMCL 1 0.900 - - OOG6_102934
Panther 1 1.100 - - LDO PTHR22629
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2219
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.