DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc4 and ARPC4

DIOPT Version :9

Sequence 1:NP_608996.1 Gene:Arpc4 / 33864 FlyBaseID:FBgn0284255 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001190726.1 Gene:ARPC4 / 3770404 AraportID:AT4G14147 Length:176 Species:Arabidopsis thaliana


Alignment Length:157 Identity:93/157 - (59%)
Similarity:120/157 - (76%) Gaps:7/157 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATLKPYLTAVRHSLTAAMCLQDFPSQVVERHNKPEVEICSSKELVLTPVVVSRNEREKVLIEP 65
            ||.:|:.||..::::|.||||||:||.|.||||||||||:.:|.||:|.||::.|||.||.|||.
plant     1 MANSLRLYLACIKNTLEAAMCLQNFPCQEVERHNKPEVELKTSPELLLNPVLICRNEAEKCLIET 65

  Fly    66 SINSVRVSIAVKQADEIERILCHKFTRFMMRRAESFVILRRKPIEGYDISFLITNFHTEQMYKHK 130
            ||||:|:|:.||||||:|.||..||.||:..|||:|.:|||||::||||||||||:|.|:|.|.|
plant    66 SINSLRISLKVKQADELENILTKKFLRFLSMRAEAFQVLRRKPVQGYDISFLITNYHCEEMQKQK 130

  Fly   131 LVDFVISFMEEIDKE-------ISEMK 150
            |:||:|.|||...:|       :||.|
plant   131 LIDFIIQFMEARYRERNKGLEGVSEYK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc4NP_608996.1 ARPC4 1..166 CDD:399097 93/157 (59%)
ARPC4NP_001190726.1 ARPC4 1..140 CDD:283507 87/138 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 212 1.000 Domainoid score I778
eggNOG 1 0.900 - - E1_KOG1876
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4177
Inparanoid 1 1.050 215 1.000 Inparanoid score I1225
OMA 1 1.010 - - QHG53638
OrthoDB 1 1.010 - - D1351067at2759
OrthoFinder 1 1.000 - - FOG0003327
OrthoInspector 1 1.000 - - oto3063
orthoMCL 1 0.900 - - OOG6_102934
Panther 1 1.100 - - LDO PTHR22629
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2219
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.