DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc4 and arx-6

DIOPT Version :9

Sequence 1:NP_608996.1 Gene:Arpc4 / 33864 FlyBaseID:FBgn0284255 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_498020.1 Gene:arx-6 / 175650 WormBaseID:WBGene00000204 Length:169 Species:Caenorhabditis elegans


Alignment Length:168 Identity:125/168 - (74%)
Similarity:154/168 - (91%) Gaps:0/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATLKPYLTAVRHSLTAAMCLQDFPSQVVERHNKPEVEICSSKELVLTPVVVSRNEREKVLIEP 65
            |:|||:|||.||||:|.||:||:.|.|||||||||||||:.:||||::|||||:||::|:|||||
 Worm     1 MSATLQPYLEAVRHTLQAALCLEQFSSQVVERHNKPEVEVQTSKELLMTPVVVARNKQERVLIEP 65

  Fly    66 SINSVRVSIAVKQADEIERILCHKFTRFMMRRAESFVILRRKPIEGYDISFLITNFHTEQMYKHK 130
            |:||||:|||:||:||||:||||||||||.:||::|.:|||||:.|||||||||..|||.|:|||
 Worm    66 SVNSVRISIAIKQSDEIEKILCHKFTRFMCQRADNFFVLRRKPLPGYDISFLITASHTEAMFKHK 130

  Fly   131 LVDFVISFMEEIDKEISEMKLAVNARARTCAEEFLKRF 168
            ||||::.||:|||||||||||::|||||..||||||||
 Worm   131 LVDFLLHFMQEIDKEISEMKLSLNARARVSAEEFLKRF 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc4NP_608996.1 ARPC4 1..166 CDD:399097 121/164 (74%)
arx-6NP_498020.1 ARPC4 1..166 CDD:283507 121/164 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166617
Domainoid 1 1.000 258 1.000 Domainoid score I1082
eggNOG 1 0.900 - - E1_KOG1876
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4177
Inparanoid 1 1.050 262 1.000 Inparanoid score I1897
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53638
OrthoDB 1 1.010 - - D1351067at2759
OrthoFinder 1 1.000 - - FOG0003327
OrthoInspector 1 1.000 - - oto19626
orthoMCL 1 0.900 - - OOG6_102934
Panther 1 1.100 - - LDO PTHR22629
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R90
SonicParanoid 1 1.000 - - X2219
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.