DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc4 and ARPC4-TTLL3

DIOPT Version :9

Sequence 1:NP_608996.1 Gene:Arpc4 / 33864 FlyBaseID:FBgn0284255 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001185722.1 Gene:ARPC4-TTLL3 / 100526693 HGNCID:38830 Length:625 Species:Homo sapiens


Alignment Length:110 Identity:86/110 - (78%)
Similarity:99/110 - (90%) Gaps:0/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATLKPYLTAVRHSLTAAMCLQDFPSQVVERHNKPEVEICSSKELVLTPVVVSRNEREKVLIEP 65
            |.|||:|||:|||.:|.||:||::|.|||||||||||||:.|||||:|.||.:||||:||||||.
Human     1 MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEKVLIEG 65

  Fly    66 SINSVRVSIAVKQADEIERILCHKFTRFMMRRAESFVILRRKPIE 110
            ||||||||||||||||||:||||||.||||.|||:|.||||||:|
Human    66 SINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc4NP_608996.1 ARPC4 1..166 CDD:399097 86/110 (78%)
ARPC4-TTLL3NP_001185722.1 ARPC4 1..>110 CDD:283507 85/108 (79%)
TTL 274..566 CDD:281171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1876
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.