DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stai and CG42585

DIOPT Version :9

Sequence 1:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001162977.1 Gene:CG42585 / 8674069 FlyBaseID:FBgn0260953 Length:349 Species:Drosophila melanogaster


Alignment Length:393 Identity:79/393 - (20%)
Similarity:138/393 - (35%) Gaps:121/393 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CKGCGQIRADFDRRYGCSECGSEVMY--CGQCFDEGRNQHTETHKDDRRIKIIYHRSFLDKFFSG 74
            |.|| |:......|:.|..|   |.|  |..|:|  ....||.|:.:..:::......|.....|
  Fly     8 CNGC-QMTIFQGSRFRCLRC---VNYNLCDICYD--HQIETEEHRANHPMQLFPDSDDLVPLLYG 66

  Fly    75 E--KLLNGDASKSYNCVFC------KKRF-----------------------SAEELQL--HLSE 106
            |  :|::  .|..:.|..|      .|||                       ||.||..  |||:
  Fly    67 EIPELVH--LSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGLSAAELVAIRHLSK 129

  Fly   107 --MHSNPADASALTVMLERMRQEDLENRIATEIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTP 169
              :|::...|:.|......:|      ||.|....:...:..|.                  .||
  Fly   130 HLLHNHIDHANYLEPDTPPLR------RIFTRNHMRHHRQSQLQ------------------TTP 170

  Fly   170 GKNVSVEEIEQKLKAAEERRISLEAKKMADISTKLAKVEEATRKKDEITNEFITQTKEQLESKME 234
              |..:.:|...|...   |:|.:.:.:::....    |||.             ..|.|...:.
  Fly   171 --NSRIFDISVWLSTG---RVSSDPQLLSNNDPP----EEAA-------------NSESLALGLS 213

  Fly   235 L-----HVEKREAIISDM-KEKLKIHAQD-IEKTRETLEQQKANEQKAIEEKLKIA---QSLRDE 289
            .     |.:.|..::..: ::|::.|..| .::.|.||..:.........|:|::.   :.:|:.
  Fly   214 SGGPFEHDDDRYVLLQWIAQQKVQCHDTDESQRLRRTLFVEHLLISMLCCEELQLPDGDRRIREG 278

  Fly   290 NIKKMLDRLKEHNTIKIAEIKS-------QNDQLECQKIE-------------EKARIYENKLFA 334
            |.:..||:....:.:|:..:.|       |.:||:..:.|             :|.:|.|:|..|
  Fly   279 NGESDLDQENHSSLVKVMSVMSLPWTGVWQTNQLDGSEGEGEIRAAKKDGVDLDKVQIEEHKRVA 343

  Fly   335 AEQ 337
            ||:
  Fly   344 AEE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staiNP_001245912.1 Stathmin 138..267 CDD:279209 21/135 (16%)
beta_CA <242..313 CDD:294276 14/82 (17%)
CG42585NP_001162977.1 ZZ_PCMF_like 6..54 CDD:239078 15/51 (29%)
zf-Di19 76..130 CDD:283297 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.