DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stai and STMN4

DIOPT Version :9

Sequence 1:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_005273709.1 Gene:STMN4 / 81551 HGNCID:16078 Length:258 Species:Homo sapiens


Alignment Length:155 Identity:57/155 - (36%)
Similarity:81/155 - (52%) Gaps:23/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ASALTVMLERMRQEDLENRIATEIRCQEKSRGGLSYEVILAEPA----P--NVAVPKRPVTPGKN 172
            |.|.||.|......|:|   ..|:   .|...|.|:||||..|:    |  |.::|:|     ::
Human    62 AQADTVDLNWCVISDME---VIEL---NKCTSGQSFEVILKPPSFDGVPEFNASLPRR-----RD 115

  Fly   173 VSVEEIEQKLKAAEERRISLEAKKMADISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHV 237
            .|:|||::||:||||||...||:.:..::.|.....|..:|..|..|.||...||:|..|||.:.
Human   116 PSLEEIQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNK 180

  Fly   238 EKREAIISDMKEKLKIHAQDIEKTR 262
            |.|||.::.|.|:|:      ||.|
Human   181 ENREAHLAAMLERLQ------EKVR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staiNP_001245912.1 Stathmin 138..267 CDD:279209 49/131 (37%)
beta_CA <242..313 CDD:294276 7/21 (33%)
STMN4XP_005273709.1 Stathmin 80..201 CDD:279209 50/134 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159120
Domainoid 1 1.000 77 1.000 Domainoid score I8855
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000827
OrthoInspector 1 1.000 - - otm42211
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10104
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5280
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.