DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stai and stmn1a

DIOPT Version :9

Sequence 1:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001035465.1 Gene:stmn1a / 678630 ZFINID:ZDB-GENE-031006-14 Length:148 Species:Danio rerio


Alignment Length:145 Identity:50/145 - (34%)
Similarity:83/145 - (57%) Gaps:11/145 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 EIRCQEKSRGGLSYEVILAEPAPNV------AVPKRPVTPGKNVSVEEIEQKLKAAEERRISLEA 194
            :::..:|...|.::||||..||.:|      :.||:     |::|:.||::||:||||||.|.||
Zfish     8 QVKELDKRASGQAFEVILGSPASDVKNEFLLSPPKK-----KDLSLVEIQKKLEAAEERRKSHEA 67

  Fly   195 KKMADISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHVEKREAIISDMKEKLKIHAQDIE 259
            :.:..::.|....:|..:|..|..|.|....:|:|..|||.:.|.|.||::.|.||.|...:.||
Zfish    68 EVLKHLAEKREHEKEVLQKALEENNNFSKMAEEKLNQKMEANKENRTAIMAAMNEKFKEKDKKIE 132

  Fly   260 KTRETLEQQKANEQK 274
            :.|:..|.::.|.::
Zfish   133 EVRKNKETKEHNGEE 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staiNP_001245912.1 Stathmin 138..267 CDD:279209 48/134 (36%)
beta_CA <242..313 CDD:294276 11/33 (33%)
stmn1aNP_001035465.1 Stathmin 6..141 CDD:307125 49/137 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595176
Domainoid 1 1.000 79 1.000 Domainoid score I8582
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000827
OrthoInspector 1 1.000 - - otm25010
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10104
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5280
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.