DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stai and stmn1b

DIOPT Version :9

Sequence 1:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001017850.1 Gene:stmn1b / 550548 ZFINID:ZDB-GENE-050417-397 Length:149 Species:Danio rerio


Alignment Length:145 Identity:47/145 - (32%)
Similarity:81/145 - (55%) Gaps:11/145 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 EIRCQEKSRGGLSYEVILAEPAPN------VAVPKRPVTPGKNVSVEEIEQKLKAAEERRISLEA 194
            :::..:|...|.::||||:..||:      ::.||:     |.||::||::||.||||||.:.||
Zfish     9 QVKELDKRASGQAFEVILSPTAPDAKGEFPLSTPKK-----KEVSLDEIQKKLDAAEERRKNHEA 68

  Fly   195 KKMADISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHVEKREAIISDMKEKLKIHAQDIE 259
            :.:..::.|....:|..:|..|..|.|....:|:|..|||.:.|.|.|.::.|.||.|...:.:|
Zfish    69 EVLKHLAEKREHEKEVLQKAMEENNNFSKMAEEKLNQKMEANKENRTARMAAMNEKFKEKDKKLE 133

  Fly   260 KTRETLEQQKANEQK 274
            :.|:..|.::..|.:
Zfish   134 EVRKNKETKEGGEDE 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staiNP_001245912.1 Stathmin 138..267 CDD:279209 45/134 (34%)
beta_CA <242..313 CDD:294276 9/33 (27%)
stmn1bNP_001017850.1 Stathmin 11..141 CDD:279209 45/134 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595179
Domainoid 1 1.000 79 1.000 Domainoid score I8582
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000827
OrthoInspector 1 1.000 - - otm25010
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10104
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.