DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stai and STMN3

DIOPT Version :9

Sequence 1:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_056978.2 Gene:STMN3 / 50861 HGNCID:15926 Length:180 Species:Homo sapiens


Alignment Length:180 Identity:51/180 - (28%)
Similarity:94/180 - (52%) Gaps:30/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ASALTVMLERMRQEDLENRIAT-----------------EIRCQEKSRGGLSYEVILAEP----- 156
            ||.::...|:|::..:.:.|.:                 |::..:|...|.|:||||..|     
Human     2 ASTISAYKEKMKELSVLSLICSCFYTQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKSPSDLSP 66

  Fly   157 -APNVAVPKRPVTPGKNVSVEEIEQKLKAAEERRISLEAKKMADISTKLAKVEEATRKKDEITNE 220
             :|.::.|.:.    |:.|:||::::|:||||||.:.||:.:..::.:.....|...|..|..|.
Human    67 ESPMLSSPPKK----KDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHKALEENNN 127

  Fly   221 FITQTKEQLESKMELHVEKREAIISDMKEKLK---IHAQDIEKTRETLEQ 267
            |..|.:|:|..||||..|.|||.::.::|:|:   :||.::.:.:|..|:
Human   128 FSRQAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staiNP_001245912.1 Stathmin 138..267 CDD:279209 44/137 (32%)
beta_CA <242..313 CDD:294276 7/29 (24%)
STMN3NP_056978.2 Stathmin 39..175 CDD:395674 45/139 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..82 4/26 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159119
Domainoid 1 1.000 77 1.000 Domainoid score I8855
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000827
OrthoInspector 1 1.000 - - otm42211
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10104
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.