DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stai and stmn1

DIOPT Version :9

Sequence 1:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001007972.1 Gene:stmn1 / 493340 XenbaseID:XB-GENE-481615 Length:145 Species:Xenopus tropicalis


Alignment Length:138 Identity:48/138 - (34%)
Similarity:80/138 - (57%) Gaps:11/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 EKSRGGLSYEVILAEP----AP--NVAVPKRPVTPGKNVSVEEIEQKLKAAEERRISLEAKKMAD 199
            ||...|.::|:||:.|    ||  ::|.||:     |..|:|||::||:||||||.|.||:.:..
 Frog    12 EKRASGQAFELILSPPSSDAAPDLSIASPKK-----KECSLEEIQKKLEAAEERRKSHEAEILKQ 71

  Fly   200 ISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHVEKREAIISDMKEKLKIHAQDIEKTRET 264
            ::.|....:|..:|..|..|.|....:|:|.:|||...|.|:|.::...|:|:...:.:|:.|:.
 Frog    72 LAEKREHEKEVLQKAIEENNNFSKMAEEKLTTKMETIKENRDAQMAAKLERLREKDKKVEEIRKG 136

  Fly   265 LEQQKANE 272
            .|.::.:|
 Frog   137 KECKEPSE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staiNP_001245912.1 Stathmin 138..267 CDD:279209 46/131 (35%)
beta_CA <242..313 CDD:294276 7/31 (23%)
stmn1NP_001007972.1 Stathmin 5..138 CDD:395674 46/130 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9153
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000827
OrthoInspector 1 1.000 - - otm49441
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.