DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stai and STMN1

DIOPT Version :9

Sequence 1:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001138926.1 Gene:STMN1 / 3925 HGNCID:6510 Length:174 Species:Homo sapiens


Alignment Length:159 Identity:50/159 - (31%)
Similarity:86/159 - (54%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 EIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTP--GKNVSVEEIEQKLKAAEERRISLEAKKMA 198
            :::..||...|.::|:||: |....:||:.|::|  .|::|:|||::||:||||||.|.||:.:.
Human     7 QVKELEKRASGQAFELILS-PRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLK 70

  Fly   199 DISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHVEKREAIISDMKEKLK------IHAQD 257
            .::.|....:|..:|..|..|.|....:|:|..|||.:.|.|||.::...|:|:      .|...
Human    71 QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKMYFWTHGPG 135

  Fly   258 IEKTRETLEQQKANEQKAIEEKLKIAQSL 286
            ....:.:.||...:...|:...|.:..:|
Human   136 AHPAQISAEQSCLHSVPALCPALGLQSAL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staiNP_001245912.1 Stathmin 138..267 CDD:279209 45/136 (33%)
beta_CA <242..313 CDD:294276 9/51 (18%)
STMN1NP_001138926.1 Stathmin 9..126 CDD:279209 44/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159118
Domainoid 1 1.000 77 1.000 Domainoid score I8855
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000827
OrthoInspector 1 1.000 - - otm42211
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10104
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.