DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stai and Stmn3

DIOPT Version :9

Sequence 1:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_033159.1 Gene:Stmn3 / 20262 MGIID:1277137 Length:180 Species:Mus musculus


Alignment Length:181 Identity:53/181 - (29%)
Similarity:93/181 - (51%) Gaps:32/181 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ASALTVMLERMRQEDLENRIAT-----------------EIRCQEKSRGGLSYEVILAEP---AP 158
            ||.::...|:|::..:.:.|.:                 |::..:|...|.|:||||..|   :|
Mouse     2 ASTVSAYKEKMKELSVLSLICSCFYSQPHPNTIYQYGDMEVKQLDKRASGQSFEVILKSPSDLSP 66

  Fly   159 NVAV----PKRPVTPGKNVSVEEIEQKLKAAEERRISLEAKKMADISTKLAKVEEATRKKDEITN 219
            ...|    |||     |:.|:||::::|:||||||.:.||:.:..::.:.....|...|..|..|
Mouse    67 ESPVLSSPPKR-----KDASLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHKALEENN 126

  Fly   220 EFITQTKEQLESKMELHVEKREAIISDMKEKLK---IHAQDIEKTRETLEQ 267
            .|....:|:|..||||..|.|||.::.::|:|:   :||.::.:.:|..|:
Mouse   127 NFSRLAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staiNP_001245912.1 Stathmin 138..267 CDD:279209 46/138 (33%)
beta_CA <242..313 CDD:294276 7/29 (24%)
Stmn3NP_033159.1 Stathmin 39..175 CDD:395674 47/140 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..81 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849491
Domainoid 1 1.000 76 1.000 Domainoid score I8915
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000827
OrthoInspector 1 1.000 - - otm44265
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10104
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5280
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.