DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stai and Stmn2

DIOPT Version :9

Sequence 1:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_079561.1 Gene:Stmn2 / 20257 MGIID:98241 Length:179 Species:Mus musculus


Alignment Length:133 Identity:48/133 - (36%)
Similarity:76/133 - (57%) Gaps:6/133 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 EIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTP-GKNVSVEEIEQKLKAAEERRISLEAKKMAD 199
            |::...|...|.::|:||..|:|....|:...:| .|::|:|||::||:||||||.|.||:.:..
Mouse    41 EVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQ 105

  Fly   200 ISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHVEKRE----AIISDMKEKLKIHAQDIEK 260
            ::.|.....|..:|..|..|.|....:|:|..|||...|.||    |||..::||.: ||.::.:
Mouse   106 LAEKREHEREVLQKALEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKER-HAAEVRR 169

  Fly   261 TRE 263
            .:|
Mouse   170 NKE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staiNP_001245912.1 Stathmin 138..267 CDD:279209 47/131 (36%)
beta_CA <242..313 CDD:294276 8/22 (36%)
Stmn2NP_079561.1 Membrane attachment. /evidence=ECO:0000255 1..26
Stathmin 39..174 CDD:395674 48/133 (36%)
Regulatory/phosphorylation domain. /evidence=ECO:0000255 39..96 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849489
Domainoid 1 1.000 76 1.000 Domainoid score I8915
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000827
OrthoInspector 1 1.000 - - otm44265
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10104
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.