DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stai and STMN2

DIOPT Version :9

Sequence 1:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001186143.1 Gene:STMN2 / 11075 HGNCID:10577 Length:187 Species:Homo sapiens


Alignment Length:147 Identity:52/147 - (35%)
Similarity:85/147 - (57%) Gaps:8/147 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 EIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTP-GKNVSVEEIEQKLKAAEERRISLEAKKMAD 199
            |::...|...|.::|:||..|:|....|:...:| .|::|:|||::||:||||||.|.||:.:..
Human    41 EVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQ 105

  Fly   200 ISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHVEKRE----AIISDMKEKL-KIHAQDIE 259
            ::.|.....|..:|..|..|.|....:|:|..|||...|.||    |||..::||| |..:.:::
Human   106 LAEKREHEREVLQKALEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKLVKFISSELK 170

  Fly   260 KTRET--LEQQKANEQK 274
            ::.|:  ||.|:..|::
Human   171 ESIESQFLELQREGEKQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staiNP_001245912.1 Stathmin 138..267 CDD:279209 48/136 (35%)
beta_CA <242..313 CDD:294276 12/36 (33%)
STMN2NP_001186143.1 Membrane attachment. /evidence=ECO:0000255 1..26
Stathmin 39..163 CDD:307125 46/121 (38%)
Regulatory/phosphorylation domain. /evidence=ECO:0000255 39..96 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159116
Domainoid 1 1.000 77 1.000 Domainoid score I8855
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000827
OrthoInspector 1 1.000 - - otm42211
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10104
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.