DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stai and Stmnd1

DIOPT Version :9

Sequence 1:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_006253834.1 Gene:Stmnd1 / 102554838 RGDID:1564013 Length:278 Species:Rattus norvegicus


Alignment Length:178 Identity:42/178 - (23%)
Similarity:74/178 - (41%) Gaps:48/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 MHSNPADASALT------VMLERMRQEDLENRIATEIRCQEKS---RGGLSYEVILAEPAPNVAV 162
            ::|:|. |:.||      ...||.:..|:...:..:...|.:|   |.|.||:|::......:..
  Rat    87 INSDPV-ANGLTNKPQLLESWERPKSSDILEELIVQGIIQSRSKVFRNGESYDVMVGTTEKPLRK 150

  Fly   163 P---------KRPVTPGKNVSVEEIEQKLKAAEERRIS--------------LEAKKMADISTKL 204
            |         |:.|   |:.:::::|:|::||||||.:              |.....:| .|:|
  Rat   151 PPARLKKLKVKKEV---KDFTIQDLEEKMQAAEERRKTKKEEIRKRLRSDRLLPTANPSD-ETEL 211

  Fly   205 AKVEEATRK-----KDEITNEFITQTKEQLESKMELHVEKREAIISDM 247
            .:||....|     ......:..||..|.|:.|      |.|:.::.|
  Rat   212 GRVEVPFTKGLPAVSAPALEKSYTQEGEPLKRK------KSESDVAQM 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staiNP_001245912.1 Stathmin 138..267 CDD:279209 34/141 (24%)
beta_CA <242..313 CDD:294276 1/6 (17%)
Stmnd1XP_006253834.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.