DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9175 and PHF1

DIOPT Version :9

Sequence 1:NP_608995.2 Gene:CG9175 / 33862 FlyBaseID:FBgn0031779 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_566961.1 Gene:PHF1 / 824384 AraportID:AT3G52190 Length:398 Species:Arabidopsis thaliana


Alignment Length:272 Identity:66/272 - (24%)
Similarity:116/272 - (42%) Gaps:56/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 LQRVVRISGNGRLMATGGTDGKLRVWTFPQMTLAAELAAHSKEIDDLDFSPDSKLIASISKDAQG 252
            ||:.:..|.:|..:|.||.||.||:..:|.:::..:.....|.|.|:|||.||:.:|:.|.|...
plant   124 LQKCMAFSFDGSKLAVGGVDGCLRIMEWPNLSVILDEPKAHKSIRDMDFSLDSEFLATTSTDGSA 188

  Fly   253 LVWDLASGQLQHKLQWKTPEGAKYLFKRCRYGTVEAQKDNYR--LFTIA----NPLGKV-----G 306
            .:|....|.....|:....|.    .:.||:     .||..:  ||..|    .|:..|     .
plant   189 RIWKAEDGFPLSTLERSGDEN----IELCRF-----SKDGTKPFLFCAAQRGDTPMVNVYDISTW 244

  Fly   307 KQRGFLQHWDCASGQLRQAVAIDESLSSLAVRDDGRFVAVGTMFSGSVSMYIAFSLQ-----RVL 366
            |:.||        .:|.:..|     |::||..||:::|:|.. .|.||:....:::     :.|
plant   245 KKLGF--------KKLSRKTA-----STMAVSLDGKYIALGGK-DGDVSVAEVKTMEIYHYSKRL 295

  Fly   367 HIPHAHSMFVTGLQFLPITNEEGPPISSDTEAAVLSISVDNKVCIHSLSQRRTIPAWIAIVFLIV 431
            |:..:    :..|:|.|            :|..:|:.|.:....:..|:..:....| .|..|:.
plant   296 HLGQS----IASLEFCP------------SERVMLTTSSEWGEMVTKLTVPKEWKEW-QIYALLF 343

  Fly   432 MIFAVFVLCSYI 443
            .:|...|:.:|:
plant   344 CLFMASVIAAYV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9175NP_608995.2 WD40 <190..>421 CDD:225201 58/246 (24%)
WD40 190..>420 CDD:295369 58/245 (24%)
WD40 repeat 190..226 CDD:293791 10/35 (29%)
WD40 repeat 231..267 CDD:293791 12/35 (34%)
WD40 repeat 296..327 CDD:293791 8/39 (21%)
PHF1NP_566961.1 WD40 repeat 78..119 CDD:293791
WD40 127..>318 CDD:421866 56/229 (24%)
WD40 repeat 127..162 CDD:293791 10/34 (29%)
WD40 repeat 168..204 CDD:293791 12/35 (34%)
WD40 repeat 210..250 CDD:293791 12/52 (23%)
WD40 repeat 258..294 CDD:293791 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0771
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2456
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D828247at2759
OrthoFinder 1 1.000 - - FOG0004751
OrthoInspector 1 1.000 - - otm2484
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23284
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.