DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9175 and mcl1

DIOPT Version :9

Sequence 1:NP_608995.2 Gene:CG9175 / 33862 FlyBaseID:FBgn0031779 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_594128.1 Gene:mcl1 / 2543387 PomBaseID:SPAPB1E7.02c Length:815 Species:Schizosaccharomyces pombe


Alignment Length:311 Identity:63/311 - (20%)
Similarity:105/311 - (33%) Gaps:91/311 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AHTRRPSDGL--LARVNFPLYAVDMLTSRHILVAGGGGSSKTGVANGFEIYELYHNGSHFCAEEV 64
            |||    |||  ||      |..|   .:.:|..|..           ::...:..||....:.:
pombe    11 AHT----DGLTRLA------YTRD---GKFLLTVGSN-----------QVIRKFQVGSDEEPDSI 51

  Fly    65 LRHE---TGANVVMNFAVRNGGRRGYLC-AGQEAHCQMYYVQ-------------PRVQSEEDGN 112
            ..|:   ||..|..|          |.| ..::|...:|.:.             |........:
pombe    52 DNHQDPITGIAVAEN----------YFCTCSEDATVCVYPIDSPTEHTLLARTTLPIRDVAYSVD 106

  Fly   113 GNGVGVGDGKPAPEE------------RPHENGNVRQRNAHSGVEPVANGHRPPLSTADILRQFR 165
            ||.:.:...:.|.:.            ||     .:..|.|....|  ||:...:|:.:.:..| 
pombe   107 GNWIAIASDETAVKVVSSTDSSQIFSLRP-----AKASNKHVTYSP--NGNFLAVSSCNGILYF- 163

  Fly   166 RLHFDIQAADVIQ--TDFLKGAEPLQRVVRISG----NGRLMATGGTDGKLRV-----WTFPQMT 219
               :|.|..::|:  |:.:...|....:...:.    || ..|...||..:.|     |......
pombe   164 ---YDTQTRELIKFLTNTIASLEAESEICSKAAWHPKNG-TFAVASTDHFVSVISPDDWLPLYKL 224

  Fly   220 LAAELAAHSKEIDDLDFSPDSKLIASISKDAQGLVWDLASGQLQHKLQWKT 270
            |..|  .|| .:.|:.:|.:...||:..|....|:||..|.::..:|.:.|
pombe   225 LPKE--NHS-GVTDISWSSNGMYIAASFKKGGILIWDTQSHEVVVELPYST 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9175NP_608995.2 WD40 <190..>421 CDD:225201 22/90 (24%)
WD40 190..>420 CDD:295369 22/90 (24%)
WD40 repeat 190..226 CDD:293791 9/44 (20%)
WD40 repeat 231..267 CDD:293791 9/35 (26%)
WD40 repeat 296..327 CDD:293791
mcl1NP_594128.1 WD40 <11..269 CDD:225201 61/306 (20%)
WD40 12..285 CDD:295369 62/310 (20%)
WD40 repeat 16..53 CDD:293791 9/56 (16%)
WD40 repeat 59..93 CDD:293791 8/43 (19%)
WD40 repeat 98..132 CDD:293791 3/33 (9%)
WD40 repeat 141..176 CDD:293791 9/40 (23%)
WD40 repeat 188..225 CDD:293791 7/37 (19%)
WD40 repeat 233..275 CDD:293791 11/40 (28%)
Mcl1_mid 416..704 CDD:289138
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.