DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9175 and tup11

DIOPT Version :9

Sequence 1:NP_608995.2 Gene:CG9175 / 33862 FlyBaseID:FBgn0031779 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_592873.1 Gene:tup11 / 2542299 PomBaseID:SPAC18B11.10 Length:614 Species:Schizosaccharomyces pombe


Alignment Length:264 Identity:47/264 - (17%)
Similarity:94/264 - (35%) Gaps:95/264 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 FDIQAADVIQTDFLKGAEPLQ----RVVRISGNGRLMATGGTDGKLRVWTFPQMTLAAELAAHSK 229
            ||:|....:.|...:..:|.:    |.:..|.:|:.:.||..|.::::|......:....:.|.:
pombe   339 FDVQTGKKLFTLHEESPDPSRDLYVRTIAFSPDGKYLVTGTEDRQIKLWDLSTQKVRYVFSGHEQ 403

  Fly   230 EIDDLDFSPDSKLIASISKDAQGLVWDLASGQLQHKLQWKTPEGAKYLFKRCRYGTVEAQKDNYR 294
            :|..||||.:.:.|.|.|.|....:||:.:||...||:                           
pombe   404 DIYSLDFSHNGRFIVSGSGDRTARLWDVETGQCILKLE--------------------------- 441

  Fly   295 LFTIANPLGKVGKQRGFLQHWDCASGQLRQAVAIDESLSSLAVRDDGRFVAVGTM--------FS 351
                                             |:..::::|:..:.:|:|||::        .|
pombe   442 ---------------------------------IENGVTAIAISPNDQFIAVGSLDQIIRVWSVS 473

  Fly   352 GSVSMYIAFSLQRVLHIPHAHSMFVTGLQFLPITNEEGPPISSDTEAAVLSISVDNKVCIHSLSQ 416
            |::       ::|:    ..|...|..:.|.|            ..:.:||.|:|..:.:..|..
pombe   474 GTL-------VERL----EGHKESVYSIAFSP------------DSSILLSGSLDKTIKVWELQA 515

  Fly   417 RRTI 420
            .|::
pombe   516 TRSV 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9175NP_608995.2 WD40 <190..>421 CDD:225201 42/239 (18%)
WD40 190..>420 CDD:295369 42/237 (18%)
WD40 repeat 190..226 CDD:293791 7/35 (20%)
WD40 repeat 231..267 CDD:293791 14/35 (40%)
WD40 repeat 296..327 CDD:293791 0/30 (0%)
tup11NP_592873.1 Tup_N 9..86 CDD:285748
WD40 <303..610 CDD:225201 47/264 (18%)
WD40 306..608 CDD:238121 47/264 (18%)
WD40 repeat 316..358 CDD:293791 4/18 (22%)
WD40 repeat 364..400 CDD:293791 7/35 (20%)
WD40 repeat 405..441 CDD:293791 14/35 (40%)
WD40 repeat 447..481 CDD:293791 8/44 (18%)
WD40 repeat 487..535 CDD:293791 9/45 (20%)
WD40 repeat 541..577 CDD:293791
WD40 repeat 583..607 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.