Sequence 1: | NP_477466.1 | Gene: | Kr-h1 / 33861 | FlyBaseID: | FBgn0266450 | Length: | 845 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001358837.1 | Gene: | GFI1B / 8328 | HGNCID: | 4238 | Length: | 352 | Species: | Homo sapiens |
Alignment Length: | 327 | Identity: | 98/327 - (29%) |
---|---|---|---|
Similarity: | 143/327 - (43%) | Gaps: | 63/327 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 141 QKQQQQQQHESITNAAPTAAPSAQRIKTEPV-GGFPASAAVVSQVRKPSASKPQFKCDQCGMTFG 204
Fly 205 SKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGLPVGIPKSPTIKPLAN----VA 265
Fly 266 AGADPYQCNVCQKTFAVPARLIRHY-RTHTGERPFECEFCHKLFSVKENLQVHRRIHT------- 322
Fly 323 ---------------KERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVI 372
Fly 373 HMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYG 437
Fly 438 SK 439 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kr-h1 | NP_477466.1 | C2H2 Zn finger | 196..216 | CDD:275368 | 3/19 (16%) |
COG5048 | <270..420 | CDD:227381 | 65/172 (38%) | ||
zf-C2H2 | 271..293 | CDD:278523 | 9/22 (41%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 286..309 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 313..338 | CDD:290200 | 10/46 (22%) | ||
C2H2 Zn finger | 329..349 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 344..366 | CDD:290200 | 9/21 (43%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 370..396 | CDD:290200 | 13/25 (52%) | ||
C2H2 Zn finger | 385..407 | CDD:275368 | 10/21 (48%) | ||
zf-H2C2_2 | 400..424 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 415..435 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2 | 441..463 | CDD:278523 | |||
C2H2 Zn finger | 443..463 | CDD:275368 | |||
GFI1B | NP_001358837.1 | C2H2 Zn finger | 165..186 | CDD:275368 | 8/20 (40%) |
C2H2 Zn finger | 194..214 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 244..264 | CDD:275368 | 8/19 (42%) | ||
COG5048 | 252..>329 | CDD:227381 | 35/78 (45%) | ||
C2H2 Zn finger | 272..292 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 284..309 | CDD:372612 | 13/26 (50%) | ||
C2H2 Zn finger | 300..320 | CDD:275368 | 10/21 (48%) | ||
C2H2 Zn finger | 328..345 | CDD:275368 | 4/16 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |