DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and IDD12

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001328388.1 Gene:IDD12 / 828206 AraportID:AT4G02670 Length:404 Species:Arabidopsis thaliana


Alignment Length:486 Identity:105/486 - (21%)
Similarity:154/486 - (31%) Gaps:178/486 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 TSHTKSHSKNQDLSLNGASGAG---------------VAAPVSTAAIELNDAGLPVGIPKSPTIK 259
            :||:.|: |...||...::.:|               |.:.|.|.. |.:......|:|.:|  .
plant     5 SSHSLSY-KLSSLSTEASASSGNNTLSTIQEFSGFHNVISSVCTHT-ETHKPKKKRGLPGNP--D 65

  Fly   260 PLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHT-- 322
            |.|.|.|        :..||.....|             |.||.|:|.|...:|||:|||.|.  
plant    66 PDAEVIA--------LSPKTLLATNR-------------FVCEICNKGFQRDQNLQLHRRGHNLP 109

  Fly   323 ------------KERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMR 375
                        |::.|.|.....|..|..   |.:...||.:.|.|                 |
plant   110 WKLKQKNTKEQQKKKVYVCPETNCAHHHPS---RALGDLTGIKKHFC-----------------R 154

  Fly   376 THTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKC 440
            .| |||.:||.:  |.|.:......|.|::           ||                  |::.
plant   155 KH-GEKKWKCEK--CSKFYAVQSDWKAHTK-----------IC------------------GTRD 187

  Fly   441 YKCTICDETFKNKKEMEAHIKGHANEVPDDEAEAAAASAAASTSAGSSAGSPSLQGVSSNSESSN 505
            |:|. |...|..|.....| :...:.:.::.|...:.|::..|:.     :|:.||.......|:
plant   188 YRCD-CGTLFSRKDTFITH-RAFCDALAEESARLHSTSSSNLTNP-----NPNFQGHHFMFNKSS 245

  Fly   506 HSPPSSPPATKKPRQARQPRVSKTVAATLSIPTSSPLS-------PSSLSST------------- 550
            ....:|.|...:|..:         .|.||.|.::.||       .:|||||             
plant   246 SLLFTSSPLFIEPSLS---------TAALSTPPTAALSATALLQKATSLSSTTFGGGGQTRSIGH 301

  Fly   551 ----------------YSPSASSMASPPPTSAHYLPVQMEADALSRD-------SGVSSAQPAH- 591
                            ...||||..........:.....:||.|:||       .|..|.:|.. 
plant   302 HRHLTNVNEFLGVDRVMMTSASSSEYDQLVVDGFTSTWQKADRLTRDFLGLTGHGGHVSVRPGDM 366

  Fly   592 -----------STYADEEPTDLSMQQVQGQL 611
                       |.| |.|..|.|.|:....|
plant   367 LEYAGGVAFPMSAY-DTESHDHSFQKAYDHL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 2/5 (40%)
COG5048 <270..420 CDD:227381 39/163 (24%)
zf-C2H2 271..293 CDD:278523 3/21 (14%)
C2H2 Zn finger 273..293 CDD:275368 3/19 (16%)
zf-H2C2_2 286..309 CDD:290200 5/22 (23%)
C2H2 Zn finger 301..321 CDD:275368 11/19 (58%)
zf-H2C2_2 313..338 CDD:290200 11/38 (29%)
C2H2 Zn finger 329..349 CDD:275368 4/19 (21%)
zf-H2C2_2 344..366 CDD:290200 5/21 (24%)
C2H2 Zn finger 357..377 CDD:275368 2/19 (11%)
zf-H2C2_2 370..396 CDD:290200 9/25 (36%)
C2H2 Zn finger 385..407 CDD:275368 5/21 (24%)
zf-H2C2_2 400..424 CDD:290200 4/23 (17%)
C2H2 Zn finger 415..435 CDD:275368 2/19 (11%)
zf-C2H2 441..463 CDD:278523 6/21 (29%)
C2H2 Zn finger 443..463 CDD:275368 5/19 (26%)
IDD12NP_001328388.1 C2H2 Zn finger 86..106 CDD:275368 11/19 (58%)
C2H2 Zn finger 128..156 CDD:275368 9/47 (19%)
C2H2 Zn finger 163..182 CDD:275368 5/31 (16%)
C2H2 Zn finger 190..206 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.