DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and znf362a

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001071201.1 Gene:znf362a / 777625 ZFINID:ZDB-GENE-061103-547 Length:448 Species:Danio rerio


Alignment Length:443 Identity:108/443 - (24%)
Similarity:180/443 - (40%) Gaps:93/443 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PPPLTATTTSVGLGVPPSGGQQEHFELLQTPQQRQMQLQLQDQHQQ-----EQQQFVSYQLAIQ- 138
            |||            |...||.::..|:...:::.|..:::..|.|     .||..:......: 
Zfish    13 PPP------------PSIPGQLDNLVLINKIKEQLMAEKIRPPHLQPTSVPSQQPLLVPSAGTEG 65

  Fly   139 -QHQ----KQQQQQQHESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQV-------------- 184
             ||.    |.||.....:...:.|..|..|:          |||::|..::              
Zfish    66 GQHNISTPKLQQMPGLHAHGTSQPDIALHAR----------PASSSVTGRILGDVNLNLDDKTAI 120

  Fly   185 ----------RKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDL----SLNGASGAGVAAP 235
                      .:....:|.......|::..| |.:.:|..|.|.....    ::.|.|..|:.. 
Zfish   121 KARGLWEDWHLRQIIDQPSRANHLSGLSLAS-SRNANHNTSESVTPSTPTSPTIGGQSRQGIPT- 183

  Fly   236 VSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPAR------LIRHYR--- 291
                      |.|..|:...|.::.|.|..|...|...::.:....:.|.      |:..|.   
Zfish   184 ----------ANLLSGLTGGPGMEALKNSGALMGPPMKSIGRGRKKIKAENTSGPLLVVPYPILA 238

  Fly   292 ---------THTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMR 347
                     |....:.:.|:.|...|..|.::|:|.:.||:.:|:||..|.:.|.::..|.:|:|
Zfish   239 SGAEQSAVITAKEGKTYRCKVCPLTFFSKSDMQIHSKSHTEAKPHKCPHCTKTFANASYLAQHLR 303

  Fly   348 IHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKP 412
            ||.|.:|:.||.|||:|.|...|..|.|.|||::||||.:|||.|.||....|:.|.|:|..:||
Zfish   304 IHLGVKPYHCSYCEKSFRQLSHLQQHTRIHTGDRPYKCLQPGCEKAFTQLSNLQSHQRSHNKDKP 368

  Fly   413 YHCDICFRDFGYNHVLKLHRVQH--YGSKCYKCTICDETFKNKKEMEAHIKGH 463
            |.|..|:|.:..:..|::|...|  ..:|.|.|::|...:.::..:..|:..|
Zfish   369 YKCSNCYRAYSDSASLQIHLSAHAIKNAKAYCCSMCGRAYTSETYLMKHMSKH 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 4/19 (21%)
COG5048 <270..420 CDD:227381 57/167 (34%)
zf-C2H2 271..293 CDD:278523 3/39 (8%)
C2H2 Zn finger 273..293 CDD:275368 3/37 (8%)
zf-H2C2_2 286..309 CDD:290200 5/34 (15%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
zf-H2C2_2 313..338 CDD:290200 9/24 (38%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 344..366 CDD:290200 12/21 (57%)
C2H2 Zn finger 357..377 CDD:275368 10/19 (53%)
zf-H2C2_2 370..396 CDD:290200 15/25 (60%)
C2H2 Zn finger 385..407 CDD:275368 10/21 (48%)
zf-H2C2_2 400..424 CDD:290200 10/23 (43%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
zf-C2H2 441..463 CDD:278523 4/21 (19%)
C2H2 Zn finger 443..463 CDD:275368 3/19 (16%)
znf362aNP_001071201.1 C2H2 Zn finger 257..277 CDD:275368 6/19 (32%)
zf-H2C2_2 269..294 CDD:290200 9/24 (38%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
zf-H2C2_2 297..322 CDD:290200 13/24 (54%)
COG5048 309..>403 CDD:227381 40/93 (43%)
C2H2 Zn finger 313..333 CDD:275368 10/19 (53%)
zf-H2C2_2 325..352 CDD:290200 15/26 (58%)
C2H2 Zn finger 341..363 CDD:275368 10/21 (48%)
zf-H2C2_2 355..379 CDD:290200 10/23 (43%)
C2H2 Zn finger 371..391 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..421 CDD:275368 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.