DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and ZBTB7A

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:XP_005259627.3 Gene:ZBTB7A / 51341 HGNCID:18078 Length:634 Species:Homo sapiens


Alignment Length:526 Identity:130/526 - (24%)
Similarity:190/526 - (36%) Gaps:175/526 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LTATTTSVGLGVPPSGGQQEHFELLQTPQ---------QRQM----------QLQLQDQHQQEQQ 128
            ||.:|.:||..:..:       .||:.|.         .||:          ||.|.||..|.. 
Human   147 LTVSTANVGDILSAA-------RLLEIPAVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRN- 203

  Fly   129 QFVSYQLAIQQHQKQQQQQQHESITNAAPTAAPSAQRIKTEPVGGFPAS-----------AAVVS 182
                 .|..:::.:..|.....|:..||..||.|.      |...|.||           ||.|:
Human   204 -----LLRAKEYLEFFQSNPMNSLPPAAAAAAASF------PWSAFGASDDDLDATKEAVAAAVA 257

  Fly   183 QVRK------------PSASKPQF--------------KCDQ---CGMTFGSKSAHTSHTKSHSK 218
            .|..            |.|.:|..              :.|:   .|..|....|..:.|:    
Human   258 AVAAGDCNGLDFYGPGPPAERPPTGDGDEGDSNPGLWPERDEDAPTGGLFPPPVAPPAATQ---- 318

  Fly   219 NQDLSLNGASGAG---VAAPVSTAAIELNDA--------------GLPV-GIPKSPTIKPL---- 261
                  ||..|.|   .||.:|.||.|..|:              |..| |:..|..::.:    
Human   319 ------NGHYGRGGEEEAASLSEAAPEPGDSPGFLSGAAEGEDGDGPDVDGLAASTLLQQMMSSV 377

  Fly   262 --ANVAAGADPYQCNVCQKTFAVPARLIRHYR-THTGERPFECEFCHKLFSVKENLQVHRRIHTK 323
              |..|||....:.....|  .|....::::. .|.|:       .:..:|.|    |.::|..|
Human   378 GRAGAAAGDSDEESRADDK--GVMDYYLKYFSGAHDGD-------VYPAWSQK----VEKKIRAK 429

  Fly   324 ERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEP 388
            .. .||.:|.:..:.:|||.||:|.||||:|::|::|:..|.:..:|.:|||.|||||||.|.: 
Human   430 AF-QKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQ- 492

  Fly   389 GCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNK 453
             ||..|..:..||.|.|.|||.:||.||.|                           | :||...
Human   493 -CGAAFAHNYDLKNHMRVHTGLRPYQCDSC---------------------------C-KTFVRS 528

  Fly   454 KEMEAHI-KGHANEVPDDEAEAAAASAAA---STSAGSSAGSPSLQGVSSNSESSNHSPPSSPPA 514
            ..:..|: |...|.||............|   |..|.::.|:|              :.||||.|
Human   529 DHLHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAP--------------AQPSSPDA 579

  Fly   515 TKKPRQ 520
            .:..::
Human   580 RRNGQE 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 5/22 (23%)
COG5048 <270..420 CDD:227381 53/150 (35%)
zf-C2H2 271..293 CDD:278523 2/22 (9%)
C2H2 Zn finger 273..293 CDD:275368 2/20 (10%)
zf-H2C2_2 286..309 CDD:290200 2/23 (9%)
C2H2 Zn finger 301..321 CDD:275368 3/19 (16%)
zf-H2C2_2 313..338 CDD:290200 6/24 (25%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 344..366 CDD:290200 11/21 (52%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 370..396 CDD:290200 15/25 (60%)
C2H2 Zn finger 385..407 CDD:275368 8/21 (38%)
zf-H2C2_2 400..424 CDD:290200 12/23 (52%)
C2H2 Zn finger 415..435 CDD:275368 3/19 (16%)
zf-C2H2 441..463 CDD:278523 5/22 (23%)
C2H2 Zn finger 443..463 CDD:275368 5/20 (25%)
ZBTB7AXP_005259627.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.